KEGG   Mus musculus (house mouse): 269423
Entry
269423            CDS       T01002                                 
Symbol
Abhd18, 2310068E01Rik, 3110057O12Rik, AI645591
Name
(RefSeq) abhydrolase domain containing 18
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: ABHD18 Peptidase_S15
Other DBs
NCBI-GeneID: 269423
NCBI-ProteinID: NP_080898
MGI: 1915468
Ensembl: ENSMUSG00000037818
UniProt: Q8C1A9
Position
3:40825532..40892573
AA seq 464 aa
MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVSSDYPVHIDKV
EEQSDCKILDGHFVSPMAHYVPGIMPIESVVARFQFIVPKEWNSRYRPVCIHLAGTGDHH
YWRRRTLMARPMIKEARMASLLLENPYYGCRKPKDQVRSSLKNVSDLFVMGGALILESAA
LLHWLEREGYGPLGMTGISMGGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKSI
NWRELEKQYYTQTVYEEEIIHMLEYCGTDSFKMGHEFMNHLPSNADKLTNLNLVSRTLNL
DMTDQVVSPKDAKCHKSGKTSISAPSNGQLLQDTAKMECLNQTLSTNKSWFASYNPQSFH
LLNREQRRSNRQKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSL
QEIWPGCEIRYLEGGHISAYLFKQGLFRQAIYDAFERFLHKYAN
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggtgtaagcaagttagatattctataccggagacttcttctcacaaaacttttcatc
agaggatggggaaggccagaagacctcaagagactctttgaattcagaaagatgattgga
aatcgagaaaggtgccagaacctggtttcaagtgactacccggtacacatcgataaggtt
gaagaacagtcagattgtaagatcctagatggacactttgtttctcccatggcccactat
gtgcctggtatcatgccaattgaatctgttgttgcaagattccagtttatcgtgcctaag
gaatggaacagcaggtaccgacctgtgtgcattcatctggctggaacaggagaccatcat
tactggaggcgcagaacactcatggctcgtcctatgattaaggaggccaggatggcttca
ttgttgttagaaaacccttattatggctgcaggaagcccaaggaccaagtaagatccagc
ttaaaaaatgtgtcagacctatttgtgatgggaggcgctcttattcttgagtctgcagct
ctcttgcactggctggagagggaaggttatggacctcttgggatgactggaatatccatg
ggaggacatatggcctccttagcagtgtccaactggcccaagcccatgccgttgattcca
tgcctgtcttggtccacagcatctggggtcttcactacgggtgtattgagtaaatcaatt
aattggcgggagctcgaaaagcagtattatacacagacagtttatgaagaagaaattatt
catatgcttgaatactgtgggacagattctttcaaaatgggacacgagttcatgaatcac
ttgcctagcaatgcagacaagctgactaacctgaatctggtttccagaactttaaattta
gatatgacagaccaagttgtatccccaaaggatgccaagtgccataagtctggtaaaaca
tctatcagtgctccttcaaatggacagctgttgcaagatacagctaagatggaatgcttg
aatcaaacgctctcgactaacaaaagttggtttgcaagttacaaccctcagtcatttcac
ctgctcaatagagaacaaagaagaagcaatcgtcaaaaagaatctttaatattcatgaaa
ggagtcatggatgaatgtactcacgtagcaaacttctcagttccagttgatccaagcctc
attatagtggtacaagccaaagaggatgcctatattccacgaacaggagttcgaagcttg
caagaaatttggcctggttgtgaaatccggtatctagaagggggtcatatcagtgcttat
ctctttaaacaaggactcttcagacaagccatctacgatgcctttgaacgtttccttcat
aaatatgctaactaa

DBGET integrated database retrieval system