KEGG   Mus musculus (mouse): 269424
Entry
269424            CDS       T01002                                 

Gene name
Jade1, AU041499, D530048A03Rik, Phf1, Phf17, mKIAA1807
Definition
(RefSeq) jade family PHD finger 1
  KO
K11347  protein Jade-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    269424 (Jade1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     269424 (Jade1)
SSDB
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD EPL1 C1_1 C1_2 Prok-RING_1 zf-RING-like
Other DBs
NCBI-GeneID: 269424
NCBI-ProteinID: NP_001123656
MGI: 1925835
Ensembl: ENSMUSG00000025764
Vega: OTTMUSG00000051244
UniProt: Q6ZPI0
Position
3; 3 B
AA seq 834 aa
MKRGRLPSSSEDSDDNGSLSTTWSQHSRSQHGRSSTCSRPEDRKPSEVFRTDLITAMKLH
DSYQLNPDDYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIASS
GSEPPALGYVDIRTLADSVCRYDLNDMDAAWLEVTNEEFKEMGMPELDEYTMERVLEEFE
QRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILK
VPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEP
ITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEV
KFKSYCPKHSSHRKPEEGLGEGAAQENGAPESSPQSPLEPYGSLEPNREEAHRVSVRKQK
LQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKINFNKPLITPKKDEEDNLAK
REQDVLFRRLQLFTHLRQDLERVRNLTYMVTRREKIKRSVCKVQEQIFTQYTKLLEQEKV
SGVPSSCSSALENMLFFNSPSVGPNAPKIEDLKWHSAFFRKQMGTSLVHPLKKSHKRDAV
QNSSGTEGKTSHKQPGLCGRREGLEVSESLLSLEKTFAEARLLSSAQQKNGVVTPDHGKR
RDNRFHCDLVKGDLKDKSFKQSHKPLRSTDTSQRHLDNTRAATSPGVGQSAPGTRKEIVP
KCNGSLVKVPITPASPVKSWGGFRIPKKGERQQQGEAHDGACHQHSDCSHLGVSRAPAKE
RAKSRLRADSENDGYAPDGEMSDSESEASEKKCIHASSTISRRTDIIRRSILAS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgaaacgaggtcgccttcccagcagcagtgaggattctgacgacaatggcagcttgtca
acgacatggtcccagcattctcgatcccagcatgggaggagtagtacctgctctagacct
gaagatcgaaagccttctgaggtgtttaggaccgacctgatcactgccatgaagttgcat
gactcctaccagctgaacccggatgactactacgtgctggctgatccctggagacaggag
tgggagaaaggggtccaggtgcctgtgagcccagggaccatcccacagcctgtggccagg
gttgtgtctgaagagaagtctctcatgttcatcaggcccaagaagtacatcgcgtcgtcc
ggctctgagcccccagcgttaggctacgtcgatatccggactctggcagacagtgtgtgt
cggtatgacctcaatgatatggatgctgcgtggctggaagtaaccaatgaagaatttaag
gagatggggatgccggagctggacgagtacaccatggaaagggtcttggaggaattcgaa
cagcgatgctatgacaatatgaatcatgccatagagacagaagagggcttggggattgaa
tacgacgaagacgttgtctgcgatgtctgccagtcacctgatggcgaggacggcaacgag
atggtgttctgtgacaagtgtaacatctgtgtgcaccaggcttgctatgggatcctcaag
gtgccagagggcagttggctatgtcgtacatgtgccctgggagttcagccaaaatgtttg
ctgtgtcccaagaaaggcggagctatgaagccgacccgcagcggaaccaagtgggtccac
gtcagctgtgccctgtggatccctgaggtaagcattggcagccctgagaagatggagccc
atcacaaaagtgtctcacattcccagcagccggtgggcgcttgtgtgcagcctctgcaat
gagaaattcggggcctccatacagtgctctgtgaagaactgccggacagccttccacgtg
acttgtgcttttgaccgtggcctggagatgaagaccatattggcagagaatgatgaagtc
aaattcaagtcctactgcccaaagcacagctcacacaggaaacccgaggagggcctgggt
gaaggagcagcccaggagaatggggcccctgagagttctccccagagccctctggagccc
tatggtagtctggagccgaatcgagaggaggcccaccgggtgagtgttcgcaagcagaag
ctacagcagctggaggatgagttctacacctttgtcaacctgctggatgtggccagggcg
ctgcggctgcctgaggaagtggtggatttcctgtaccagtactggaagttgaagaggaag
atcaacttcaacaagcccctcatcaccccaaagaaagacgaagaggacaatctagccaag
cgggagcaggatgtcttgtttaggaggctgcagctgttcacgcacctgcggcaggacctg
gagagggttcggaacctcacttacatggtgacccgcagggaaaagattaaacggtctgtg
tgcaaagtccaggaacaaattttcactcagtacactaagctcttggagcaagaaaaagtt
tcaggtgtgccttcttcctgctcctccgcactggagaacatgctttttttcaacagtcct
tctgtgggccccaatgctcccaagatagaggacttgaaatggcattctgcattcttcagg
aaacaaatgggcacttccttggttcatccactgaaaaagtcccataaacgagatgcagtg
cagaatagttctgggaccgagggcaagacctcgcataagcagccaggtctttgtggtaga
agggaggggctggaggtctcagaaagcttgctgagcttagaaaagacttttgcagaagca
cgtctcctatcatcagcacaacagaaaaatggtgtggtgaccccagaccatgggaaaaga
agagacaatcgttttcattgtgatctcgttaaaggagacttaaaggacaaatcttttaag
cagagtcacaagcctctcaggtccacagacacatcccagaggcatctggacaacacaaga
gctgccacctcccctggagtagggcagtcagcacctggcaccaggaaggagattgtgccc
aagtgcaatggctccctagtcaaagtgcctataacacctgccagcccagtgaaaagctgg
ggaggattccggattccaaagaagggggagcggcagcagcaaggagaagcccatgatggg
gcctgccaccagcactcagactgctcccatctgggtgtaagccgagctccagccaaggag
agagcgaagagcaggttaagagctgacagtgagaatgatgggtacgcccctgatggggaa
atgagtgactcagagagcgaggcatcagagaagaaatgtatccatgccagcagcaccatc
agcaggaggacagatatcatcaggcgaagcatcttggcctcttga

DBGET integrated database retrieval system