KEGG   Mus musculus (mouse): 269470
Entry
269470            CDS       T01002                                 

Symbol
Wdr3, AW546279, D030020G18Rik
Name
(RefSeq) WD repeat domain 3
  KO
K14556  U3 small nucleolar RNA-associated protein 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    269470 (Wdr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    269470 (Wdr3)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    269470 (Wdr3)
SSDB
Motif
Pfam: WD40 Utp12 ANAPC4_WD40 WD40_like Utp21
Other DBs
NCBI-GeneID: 269470
NCBI-ProteinID: NP_780761
MGI: 2443143
Ensembl: ENSMUSG00000033285
Vega: OTTMUSG00000006955
UniProt: Q8BHB4
Position
3; 3 F2.2
AA seq 942 aa
MGLTKQYLRYVASAVFGLIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILI
LQGNKQEVTCLCPSPDGLHLAVGYEDGAIRIFSLLSGEGNITFNGHKAAVTSLKYDQLGG
RLASGSKDTDVIIWDVINESGLYRLKGHKDAVTQALFLRERNLLVTSGKDTMVKWWDLDN
QHCFKTMVGHRTEVWGLVLVSEEKRLITGAADSELRAWDIDYLQEIDDPEEPEPKKIKEC
PGIQDTPESEDSTLEADDEKSEDRILSCSKAGSIMREGRDRVVNLAVDKTGRILACHGTD
SVLEVFCILSKAEVQKKMDKKLKKARKKARLNSANEEEDPETSVSMTLQDEILRVAKIKT
SAKIKSFDLIHSPQGELKAVFLLQNNLVELYSLNASLPAPQPVRTSRITIGGHRSDVRTL
SFSSDNIAVLSAAADSIKIWNRSTLQCIRTMPCEYALCSFFVPGDRQVVIGTKTGNLQLY
DLASGTLLETIAAHDGALWSMSLSPDQRGFVTGGADKAVKFWDFELVTDKNSTQKRLSVK
QTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKVFYVDTLKFFLSLYGHKLPVLCMDISH
DGALIATGSADRNVKIWGLDFGDCHRSLFAHDDSVMYLRFVPKSHLFFTAGKDHKIKQWD
ADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSASHDKSLRLWERTREPLILEEEREMQREA
EYEESVAKEDQPAVPGETQGDNYFTGKKTIETVKAAERIMEAIELHREETAKMKEHRAIC
KAAGKEVPLPVNPILMAHGNISPSAYVLETFKGIRSSELEEALLVLPFSYVPDVLTLFNE
FIQTGLDVELLCRCLFFLLRIHFGQITSNQMLVPVIEKLKETTISKVRQVQDAIGFNMAG
LDYLKRECEAKSEVMFFAEATSHLEEKKKKRKNRKRMILTLT
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggggcttactaaacagtatctgcgctatgtggctagtgctgtctttggcttgattggc
agccaaaaaggtaacattgtttttgtgacactccgtggtgagaaaggacgctatgtggca
gtacccgcctgtgaacacgtttttatctgggacttaaggaaaggcgagaagatccttatc
cttcaggggaataaacaagaagtcacttgcttgtgtccttccccagatgggctgcatcta
gctgttggctatgaggatggagccatccgaatcttcagcctcctcagtggtgaaggaaac
ataaccttcaatggacacaaagcagctgtcaccagcttaaagtacgatcagctaggaggc
aggctggcttctgggtctaaggatacagatgtcattatttgggatgtgatcaatgaaagt
ggcctctaccgtctaaagggacacaaggatgctgtcacacaagctttgtttctccgagaa
aggaatctgctggttacaagtgggaaagacactatggtaaagtggtgggacctggataac
cagcactgcttcaaaacaatggttggccaccgaactgaggtgtggggcttggttctggtt
tcagaagaaaagcgactaatcactggggctgcagacagtgagctgagagcctgggacatc
gactatctgcaagagattgatgacccagaagaaccagagcccaagaaaatcaaagagtgt
cctggaatacaggacacacctgaatcagaggacagcacccttgaggcggatgatgaaaaa
tctgaagatcgcatactttcgtgtagtaaagctggctccataatgcgggaaggaagggac
agagttgtgaacctcgccgtggacaagacaggcaggattcttgcttgccacggaactgat
tctgtgttagaagtattttgtattctttccaaagcagaagttcagaagaaaatggataag
aagctaaagaaagctagaaagaaagcaaggttgaactctgccaatgaggaggaggaccct
gaaacgagtgtctcgatgacactgcaggacgagatccttcgagtagccaagatcaagact
tctgccaagatcaaatcttttgacctgattcactcgcctcaaggagagttaaaggccgtc
ttcttgctgcagaacaatctggtggagttgtattcgctcaatgcgtccttgccagcccct
cagcctgtgaggacaagccggatcaccattggaggccaccgcagcgacgtgcgcactttg
tccttcagctcggataatatagctgtgctttcagcagcagccgattccattaagatctgg
aacaggtctaccctgcagtgtatccgcaccatgccttgtgaatatgctctctgctccttc
ttcgttcccggcgataggcaggtggtcataggaacaaagacaggaaatctgcaactttac
gacctggcctcaggcactctcttggagacaatagctgcccatgatggagccctgtggtcc
atgtctctttctccagatcagcgtggctttgtgacaggtggcgctgacaaagctgtcaag
ttctgggattttgagttggtgacagataaaaatagtacccagaagagactttctgtgaag
cagactcgaaccttgcagctagatgaggacgtcctgtgtgtcagctactctcccaatcaa
aagctgctggctgtgtctttgctggactgcactgtgaaggttttctatgttgacacttta
aagttttttctctcactgtatggacacaaactgcctgttttatgcatggacatctcccat
gatggagcactaatagcaactggttctgctgatagaaatgtgaaaatctggggtctggac
tttggggactgccacaggtctctctttgcacatgatgacagtgtgatgtatctacgcttt
gtgcctaagtctcacctcttcttcaccgctgggaaggaccacaagatcaagcagtgggat
gcagacaagtttgagcacatccaaacgctggagggacaccaccaggaaatatggtgtttg
gctgtcagccccagtggagactacgttgtatcagcatctcatgacaagtcgctgagactc
tgggagagaacgagagagcctcttattctcgaggaagaaagggaaatgcaaagggaagca
gagtatgaggagagcgtggccaaagaagaccagccggcagttccaggggagacccaaggt
gacaactatttcactgggaagaagacaattgaaacagtcaaagcggctgagaggatcatg
gaggccatcgagctgcatcgagaagaaactgcaaaaatgaaagaacacagagccatttgt
aaagcagcggggaaagaggttcctcttcctgtcaaccccatcctgatggctcatggcaat
atttctccttcagcgtatgtgttagagacttttaaagggatcaggtcaagtgaactagaa
gaggccctgcttgtgctgccattctcctatgtcccagacgttcttacactgttcaatgaa
ttcatccagacgggcttggatgtcgagctcttgtgccggtgcctcttttttctcctcagg
attcactttggccagatcaccagcaaccagatgcttgtgcccgtgatagagaaactaaag
gaaacaactatttcaaaagtcagacaagtccaggatgccattggcttcaatatggctggt
ctcgattatctcaagagagagtgtgaagcaaagagtgaagtgatgttttttgcagaagct
actagtcacttggaagagaagaagaaaaaacgaaaaaacaggaaaaggatgattttaaca
ctgacttag

DBGET integrated database retrieval system