KEGG   Mus musculus (mouse): 26949
Entry
26949             CDS       T01002                                 

Gene name
Vat1, VAT, VAT-1
Definition
(RefSeq) vesicle amine transport 1
  KO
K23167  synaptic vesicle membrane protein VAT-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    26949 (Vat1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    26949 (Vat1)
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N
Other DBs
NCBI-GeneID: 26949
NCBI-ProteinID: NP_036167
MGI: 1349450
Ensembl: ENSMUSG00000034993
Vega: OTTMUSG00000002873
UniProt: Q62465 Q499X4
Position
11; 11 D
AA seq 406 aa
MSAEREAAEAATVAAATEAGAETGTGAGEGAPSQPPTVEVASDPQPPPAPEASASASAPP
LRCLVLTGFGGYDKVKLQSRPAVPPAPGPGQLTLRVRACGLNFADLMGRQGLYDRLPPLP
VTPGMEGAGVVVAVGEGVGDRKAGDRVMVLNRSGMWQEEVTVPSAQTFLMPEAMTFEEAA
ALLVNYITAYMVLFDFGNLRPGHSVLVHMAAGGVGMAALQLCRTVENVTVFGTASASKHE
VLKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYHLLKPMGKVVTYGM
ANLLTGPKRNLMAMARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVNSVVTRLVA
LYNQGHIKPRIDSVWPFEKVADAMKQMQEKKNIGKVLLVPGPEKET
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtccgcggagagggaagcagctgaggcggccactgtggcagcggcgaccgaggccggg
gcggagaccgggaccggagccggggagggtgcgccttcgcagcccccgacagtcgaggtg
gcaagcgacccgcagccacccccggcccccgaagcgtcagcatccgcttcggcaccgcca
ctgcgctgcctggtactcaccggcttcggtggctacgataaggtgaagctgcagagccgg
ccggcggtgcccccggccccgggtccgggtcaattgacgctgcgcgtgcgagcctgtggg
ctcaacttcgccgacctcatgggccgccaagggctgtacgaccgactaccgcctctgccg
gtcacccccggcatggagggcgcgggcgtggtagtggcagtgggcgaaggcgtcggcgac
cgtaaggcaggggatcgggtgatggtgttgaaccggtcagggatgtggcaggaggaagta
actgtgccatcagcccagactttcctgatgcctgaggccatgacctttgaagaagctgct
gccttgctggtcaattatatcaccgcctacatggttctctttgacttcggcaacctgaga
ccgggccatagcgtcttggtacacatggctgcaggtggcgtgggcatggcagccctgcag
ttgtgccgcaccgtggagaacgtgacagtgtttggaacggcctcagccagcaagcacgag
gtgctgaaggagaacggggtcacacaccccatcgactaccacacgactgactatgtggac
gagatcaaaaagatctcccccaaaggagtagacatcgtcatggaccctctgggtggatca
gacacggccaagggctaccacctcctcaaacccatgggcaaagttgtcacttacggaatg
gctaacctgctgacgggccccaagcggaacctgatggccatggcccgcacctggtggaat
cagttcagtgtgacagctctgcagctgctgcaggccaaccgagctgtgtgtggcttccac
ctgggctacctggatggagaggtggaactcgtcaatagcgtggtcacccgcctcgtggct
ctgtacaatcagggccacatcaaacctcgaattgactcagtctggcccttcgagaaggtg
gcagatgcaatgaaacagatgcaggagaagaagaacataggcaaagtcctcctggttcct
gggcctgagaaggagacctag

DBGET integrated database retrieval system