KEGG   Mus musculus (house mouse): 26951
Entry
26951             CDS       T01002                                 
Symbol
Zw10, 6330566F14Rik, MmZw10
Name
(RefSeq) zw10 kinetochore protein
  KO
K11578  protein transport protein DSL1/ZW10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    26951 (Zw10)
   03036 Chromosome and associated proteins [BR:mmu03036]
    26951 (Zw10)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   NRZ (DSL1) complex
    26951 (Zw10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      26951 (Zw10)
SSDB
Motif
Pfam: Zw10 COG5 Vps53_N Sec8_exocyst Vps51 Exonuc_VII_L
Other DBs
NCBI-GeneID: 26951
NCBI-ProteinID: NP_036169
MGI: 1349478
Ensembl: ENSMUSG00000032264
UniProt: O54692
Position
9:48966880..48990075
AA seq 779 aa
MASFVTEVLAHSGSLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPTMQSAQALV
TQVDTLSNDIDQLKSRIETEVCRDLHISTVEFTNLKQQLERDSVVLTLLKQLQEFSSAIE
EYNSALAEKKYIPAARHLEEAQECLKLLKSRKCFDLKMLKSLSMELTVQKQNILYHLGED
WQKLVVWKFPPAKDTSSLESCLQTELHLCTEQPEKEDMTPLPSISSVLLAFSILGELPTK
LKSFGQMLLKYILKPLVTCPSLHAVIERQPSSVSICFESLTTDLEHPSPPEAFAKIRLVL
EVLQKQLLDLPLDADLEIGKVPGIVLAEMLGEGIWEDLSECLIRNCLVYSIPTNSSKLQE
YEEIIQSTEEFEKFLKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH
NTVKIGPDCKEALPDLPSPDADHKLQVQTVCKAQFTDAGNLEPETSLDPQSFSLPTCRIS
EAVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLRKLPQLAAI
HHNNCMYIAHHLLTLGHQFRLRLAPILCDGTTTFVDLVPGFRRLGTECFLAQMQAQKGEL
LERLSSARSFANMDDEENYSAASKAVRQVLHQLRRLGIVWQDVLPVNIYCKAMGTLLNTA
IAEMMSRITALEDISTEDGDRLYSLCKTVMDEGPQVFAPLSDENKNKKYQEEVPVYVSKW
MPFKELMIMLQASLQEIGDRWADGKGPLATAFPSSEVKALIRALFQNTERRAAALAKIK
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggcctctttcgtgacagaagtcttggcccactcggggagcctggagaaggaggatctg
ggcaccaggatcagccgcctgacccggcgggtggaggagatcaagggtgaagtatgcaat
atgatcagcaagaagtacagtgagttcctgcctaccatgcagagtgcgcaggccctagtt
acccaggtggacactctatctaacgacatcgaccagctgaaatccaggatagagactgag
gtctgtcgggatcttcacatatcaactgttgagtttacaaacctgaagcagcagctggaa
agagactctgtagtcctaactctgctcaaacaactccaagagttttcctctgctattgaa
gagtataacagtgcgttagcagagaagaagtacatccctgctgctcggcacctggaggag
gctcaggagtgcttgaagttattaaagtccagaaaatgctttgacttaaaaatgttgaag
tctctcagcatggagctcaccgtgcagaagcagaacatactgtaccacctgggagaagac
tggcagaagctggttgtatggaagtttccgccggcaaaagataccagcagcttagagtct
tgtctacaaacagagcttcatttatgcactgagcagccggagaaagaggacatgactcct
ctgccgtccatcagttctgtcctcttggccttttccattcttggagaattacccaccaag
ctgaagtcatttggtcagatgctgctgaagtatatccttaagcctctggtgacctgcccg
tcgctccatgctgtgattgaaaggcagccaagttcagttagcatttgtttcgagtctctg
acgacggacttggaacacccatcaccacccgaagcttttgcaaagatccgattggtcctg
gaagtgctccagaaacagcttctagatttgcctcttgatgctgacctagaaattggaaaa
gtccctgggatcgtgttggctgagatgcttggtgaggggatctgggaggacctttctgag
tgcctcatcagaaactgcttggtttactctattcccacaaacagcagcaagctccaggaa
tacgaagagattatacagtccacagaagaatttgaaaagttcctaaaggagatgaggttt
ttaaaaggcgatactactgacttgctgaaatatgctcgcaatatcaattctcattttgct
aataagaagtgccaggatgtgattgtggcggctagaaatctcatgacctctgagattcac
aacactgtcaagattggtcccgattgtaaggaagccttaccagacttacccagtcctgat
gctgatcacaagctacaagtacagacggtctgcaaagcgcagttcaccgacgccgggaac
ctagagcctgagacttctctggaccctcagtccttttctttacccacgtgccgcatcagc
gaggctgtgaagaagttaatggagctcgcttatcagactttacttgaggcaacaacaagt
agcgaccaatgtgctgtccagctcttctactcagtgaggaatatcttccatttgttccat
gatgtggtaccaacataccacaaggagaaccttcggaagctcccccagttggctgccatt
caccacaacaactgcatgtatattgctcaccacttgctgaccctcggtcatcagttcaga
ttgcggctcgcccccatcctttgcgatggcacgaccacctttgtggatcttgtacctggc
ttcagaagacttgggacggagtgctttttggcccaaatgcaggcacagaaaggagaactt
ctggagagattgtcaagtgctagaagctttgcgaacatggacgacgaagagaattactct
gcagcgagcaaggcagtgaggcaggtgctgcaccagctaaggagacttgggatcgtgtgg
caggatgtcctgccagtgaacatatactgcaaggccatggggaccttgctgaacacagcg
attgctgagatgatgagcaggatcactgctctagaggacatctcgactgaagatggtgat
agattgtattccctgtgcaaaacagtgatggatgaaggtccacaagtgtttgcacctctg
tctgatgaaaacaaaaacaagaaataccaagaagaggttcccgtctatgtgtccaaatgg
atgcctttcaaagaactcatgataatgctacaagctagcttgcaagaaattggagatcgg
tgggcagatggaaaagggcccctggcaactgcattcccttccagcgaagtcaaagcttta
atccgtgccttgttccagaacacagaaagaagagcagctgcccttgctaagattaaatag

DBGET integrated database retrieval system