KEGG   Mus musculus (mouse): 269513
Entry
269513            CDS       T01002                                 

Symbol
Nkain3, C530048M05, E130310K16Rik
Name
(RefSeq) Na+/K+ transporting ATPase interacting 3
  KO
K22735  sodium/potassium-transporting ATPase subunit beta-1-interacting protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    269513 (Nkain3)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   269513 (Nkain3)
SSDB
Motif
Pfam: NKAIN
Other DBs
NCBI-GeneID: 269513
NCBI-ProteinID: NP_001277339
MGI: 2444830
Ensembl: ENSMUSG00000055761
Vega: OTTMUSG00000004653
UniProt: Q3URJ8
Position
4; 4 A3
AA seq 181 aa
MGCCTGRCSLVCLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPR
YIMVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLP
PSAHGMMDDYTYVSVTGCVVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTCRN
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atgggctgctgcaccgggcgctgctcgctggtctgtctctgcgcactgcagctgctttca
gcattggagaggcagatctttgacttccttggcttccagtgggcacccattcttggaaat
ttcctgcatataatagttgtcatattgggtctgtttggaaccattcagtatagaccacgt
tacatcatggtgtatacagtgtggactgctctctgggtcacttggaatgtgttcatcatc
tgcttttatttggaagtaggaggcctctctaaggacacagatctgatgaccttcaacatc
tctgtacaccggtcatggtggagggagcatggacctggctgtgtccggagagtgctacca
ccatcagcccatggcatgatggatgactacacatacgtctcagtcacaggctgtgttgtc
gatttccagtacctagaggtcatccacagcgctgtacaaatactgctatcgctggttggt
tttgtgtatgcctgttatgtgatcagcatttccatggaagaagaagacacctgtcgaaat
aagtaa

DBGET integrated database retrieval system