KEGG   Mus musculus (mouse): 269587
Entry
269587            CDS       T01002                                 

Gene name
Epb41, 4.1R, AI415518, D4Ertd442e, Elp-1, Elp1, Epb4.1, mKIAA4056
Definition
(RefSeq) erythrocyte membrane protein band 4.1
  KO
K06107  erythrocyte membrane protein band 4.1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    269587 (Epb41)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     269587 (Epb41)
SSDB
Motif
Pfam: 4_1_CTD FERM_C SAB FERM_N FA FERM_M YAcAr
Other DBs
NCBI-GeneID: 269587
NCBI-ProteinID: NP_906273
MGI: 95401
Ensembl: ENSMUSG00000028906
Vega: OTTMUSG00000009743
UniProt: P48193
Position
4 D2.3; 4 64.54 cM
AA seq 858 aa
MTTEKSLAAEAENSQHQQQKEEGEGATNSGQQETQLEEASQAAAAEGSDQGEQKLKASNG
DTPTHEDLTKNKERTSESRGLSRLLSSFLKRPKSQVSEEEGREVESEKEKGEGGQKEIEL
GNSLDEDIILKAPIAAPEPELKTDPSLDLHSLSSIETQPAQEEHREDPDSETKEGEGIEE
CSGTEVKEDPESRAEREPEASQKPVRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRV
CEHLNLLEEDYFGLALWDSATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGMDYVSDFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEHYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAAAAESTDRSPRPTSAPAIAQSQVTEGPGAPIKKTPKEAVKVEEKRGEEPAEPA
EPEPTEAWKVEKTHTEVTVPTSNGDQTQKLAGKGEDLIRMRKKKRERLDGENIYIRHSNL
MLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQVPTG
DGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQTEDSNGDLDPGVLLT
AQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHP
DMSVTKVVVHQETEISEE
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgacaacagagaagagtttagcggctgaagctgagaattctcagcaccagcaacagaag
gaagaaggagagggagccacaaactcaggccaacaagaaactcagctggaggaggcctcc
caagcggccgcagctgagggcagcgatcagggtgagcagaagctgaaagcatccaatggg
gacactccaacacatgaagacttgaccaagaacaaggaacggacatcagaaagcagaggc
ctgtcacgactgctctcctcattcctcaaaaggcccaagtcgcaggtctctgaagaagaa
ggcagagaagtagaatcagagaaagagaaaggtgaagggggtcagaaggagatagaactt
ggaaacagccttgatgaagacatcattttaaaggcccccattgcagctcctgaacctgag
ctcaaaacagacccatctttggatcttcattcattaagcagtatagagacacagccagct
caggaagaacacagagaggacccagattctgaaacgaaggaaggagaagggattgaagag
tgctctggaacagaggtgaaagaggacccagagtcaagagcagagagagaacccgaagcc
tcccagaagcccgtcagaagacacagaaacatgcactgtaaggtctccttgttggatgac
acggtctacgaatgtgttgtagagaaacatgctaagggacaagacttgctgaagcgagtg
tgcgagcacctcaaccttttggaagaagactactttggtttagccctgtgggacagcgca
acctctaagacatggctggattctgccaaagaaataaaaaagcaggttcgaggtgttcct
tggaatttcacatttaatgtgaagttttatccacccgacccagcacaattaacagaagac
ataacaagatactatttatgtcttcagcttcggcaggacattgttgctggacgtctgccc
tgttcctttgcaactttagccctactcgggtcttacacgatccagtctgagctgggagac
tatgacccagaactgcacggcatggattatgttagtgattttaaactggctccaaatcag
accaaggaacttgaagaaaaggtcatggaattgcataaatcatacaggtccatgactcca
gctcaggctgacttggaatttcttgagaatgccaaaaagttgtccatgtatggagttgat
cttcacaaagcaaaggacttggagggagtggacattattctcggcgtctgctccagcggc
cttctggtttacaaagacaagttgagaattaaccgctttccttggcccaaagtgctaaag
atttcttacaaacgcagcagcttcttcatcaagatccggcctggagagcaagaacattat
gaaagtaccatcggcttcaagctccccagttatcgagcggccaagaaactatggaaggtc
tgtgtggagcatcacacgttcttcagactcacctctacagacaccatccccaaaagcaag
tttcttgccctgggatccaaattccgatacagtggccggactcaagctcagaccaggcaa
gccagtgccctgattgacaggcctgctccacactttgagcggacagcaagcaagcgggcg
tccaggagcctcgatggagcagcagctgctgagtccacagaccgaagtcctcggcccacc
tctgccccagccattgctcagagtcaggtcacagaagggccaggggcacctatcaaaaaa
acaccaaaggaagctgtgaaggttgaagagaagcggggagaagagccggctgagcccgct
gagccggagcccacagaagcatggaaggtggaaaaaacccacaccgaggtcacagtacct
acctcaaatggtgaccaaacgcagaagcttgcaggaaaaggtgaagatctgataagaatg
aggaagaaaaagagagagagactagatggtgaaaacatttatatcagacatagcaattta
atgttggaggatttagacaagagtcaagaagagatcaaaaagcaccatgccagcatcagt
gaactgaaaaagaactttatggaatcggtacccgaaccacggcccagcgagtgggacaag
cgcttatctacacactcacccttccggactcttaacatcaacgggcaagtccctactgga
gatggacctcctctggtaaagactcaaactgtcaccatctcagatactgccaatgctgtg
aaaagtgaaatcccaaccaaagatgtccctattgtccacactgagaccaagaccatcacc
tatgaagctgcccagactgaggacagcaatggggacttagaccctggagtcttgctgaca
gcccagaccatcacatccgagaccacaagtagtacaaccacgacacagattaccaagact
gtaaaaggtgggatttctgagacccggatcgagaagagaattgtgatcacaggagatgcc
gatatcgaccatgatcaggtccttgtacaagccatcaaggaagccaaggagcagcatcca
gacatgtcagtgaccaaggtggtcgtccaccaggagacagagatctctgaggagtga

DBGET integrated database retrieval system