KEGG   Mus musculus (mouse): 269589Help
Entry
269589            CDS       T01002                                 

Gene name
Sytl1, 9030417L18, PSGL-1, Slp1
Definition
(RefSeq) synaptotagmin-like 1
  KO
K17598  synaptotagmin-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    269589 (Sytl1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    269589 (Sytl1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     269589 (Sytl1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    269589 (Sytl1)
  Small GTPases and associated proteins
   Rab associated proteins
    269589 (Sytl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 FYVE_2
Motif
Other DBs
NCBI-GeneID: 269589
NCBI-ProteinID: NP_113570
MGI: 1933365
Ensembl: ENSMUSG00000028860
Vega: OTTMUSG00000010476
UniProt: Q6KAP5 A2AE94
Position
4; 4 D2.3
AA seq 568 aa AA seqDB search
MPQRGHPSQERLWALPSLPMAHGPGSEAEGLLDLSFLTEEEQEAISDVLKRDAHLRQLEE
GRVSKLRASLEDPWQLKILTGDWFQEARSQRHHHAHFGSDLVRASIRRKKSPKGDQALGS
DGEAEAAGENTIEGEPESRVSIEVAAPERNTETQGPDLFSPYVPSKASEGQEEEPQDQEC
ELEAPGEGGVQVAEADPELDPEQKAEQESQPTPAQSKATSKILENGEEAPGLGPSLDRML
SSSSSVSSLNSSTLSGSLMSLSGEAEAGTVQVRGSVLFSLRYEPGTSELRVQVIQCQGLA
AARRRRSDPYVKSYLLPDKQSKRKTSVKKRNLNPIFNETLRHSVQQADLPGRVLSLSVWH
RESLGRNIFLGEVEVPLDTWNWDSEATWLPLQPRVPPSPDELPSRGLLSLSLKYVPAGSE
GGGQPQSGELHFWVKEAQSLVPLRPGSLDTYIQCSVLPDDSRASRQRTRVVRRSLSPVFN
HTMVYDGFGPADLRQACAELSLWDHGALASRQLGGTRLSLGTGSSYGLQVPWMDSTPEEK
QLWQTLLERPCEWVDGLLPLRTNLVPRA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccccagagaggccacccatctcaggagaggctttgggccctgccctccctccccatg
gcacatggaccaggatctgaagctgaggggttgctggacctcagcttcctgacagaggag
gaacaggaggccatctctgatgtcctcaaacgagatgcccacctgcgccagctggaggaa
gggcgggtcagcaagctccgggcctccctggaagacccctggcagctgaagatcctgaca
ggggactggttccaagaagcgcgttcccagaggcaccatcacgcccattttggttctgac
ctcgtccgggcttctatccgaaggaagaagagcccaaagggggaccaggctctggggagt
gatggtgaagcagaggctgctggggaaaacaccattgaaggagagccggagtccagggtc
tccatagaggtggcagctccagagagaaacactgagacccaagggcctgatttgttctca
ccatatgtaccctcaaaggcttccgaaggtcaggaggaggagccccaggaccaggaatgt
gagctggaggcccctggcgaagggggtgtgcaggtggcagaggcggacccagagctggat
cctgagcagaaggcggagcaggagtcccagccaactccagcccagtccaaggcgacctcc
aagatcctggagaatggagaagaggccccggggctcggcccctctcttgaccgcatgctc
agcagcagctcctctgtgtccagcctcaattcctctacgctgagcggcagcctgatgagc
ctatccggggaggcagaggcaggcacggtgcaggtgcgaggctccgtgctcttctcgctg
cgctacgagcctggcacctctgagctgcgagtacaggtgatccagtgccagggcctggcc
gctgcccggcgacgccgctccgatccctacgtgaaaagctacctcctcccggataagcag
agcaagcgtaagacgtcagtgaagaaacggaatctgaacccgatcttcaacgagactctg
cggcactctgtccagcaggctgatctcccaggccgcgtgctgagcctgtccgtgtggcac
cgggaaagtctgggtcgcaacatcttcctgggagaagtagaagtgcccctagacacatgg
aactgggactctgaggctacctggctccccctgcagcctcgggttcctccatctccagat
gagcttcccagccgtggactgctgtctctgtcccttaagtatgtccctgccggctcagag
ggaggaggacagcctcagagtggggagttacacttctgggtaaaggaagctcagagcctg
gtaccactgcgaccaggatccctggacacttacattcaatgctcagtgctgcctgatgac
agtcgggccagccgccaacgcacaagagtggttcgaagaagtctcagccctgtgttcaac
cacaccatggtttatgacggcttcgggcctgctgacctacgccaggcctgtgccgagctc
tccctgtgggaccatggggccctggccagtcgccagctggggggcacacgcctcagcctt
ggtacaggcagcagttatgggcttcaggtgccctggatggattccacaccggaggagaag
cagctgtggcagacactcctggagcggccctgtgagtgggtggatggccttctgcccctc
agaaccaacctggtccccagggcatag

DBGET integrated database retrieval system