KEGG   Mus musculus (mouse): 269604Help
Entry
269604            CDS       T01002                                 

Gene name
Gpr157, F730108M23Rik
Definition
(RefSeq) G protein-coupled receptor 157
  KO
K08467  G protein-coupled receptor 157
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    269604 (Gpr157)
G protein-coupled receptors [BR:mmu04030]
 Others
  Others
   Orphan GPCRs
    269604 (Gpr157)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 Dicty_CAR Frizzled 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 269604
NCBI-ProteinID: NP_796340
MGI: 2442046
Ensembl: ENSMUSG00000047875
Vega: OTTMUSG00000010392
UniProt: Q8C206 Q148S2
Position
4; 4 E2
AA seq 330 aa AA seqDB search
MPSPAPPTELLPWERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLS
AASYFYGVLQDFAGTSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRTTRGPSTDHL
IWAFHLISWGVPLAITVAAVSLKKIGYDASDVSVGWCWINLEAEDRVLWMLLTGKLWEML
AYILLPLLYLLVRKHINRAHQALSEYRPICEGRQLQRGSSTSTADKKLVLIPLIFICLRV
WSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCPR
PSTQSPPGAPTPPKIGESQESRRTPEVPST
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccctcacccgcgcctcccaccgagctgctgccgtgggagcgcgcggtggtgctgctg
tcgtgtgcgctgtcagctctgggctcgggcctcctggtggccacgcacgccctgtggcct
gacctgcgtagccgggcgcggcgcctgctactcttcctgtcgctagcggacctgctctcg
gctgcctcgtacttctacggagtgctgcaggactttgcgggcacttcgtgggattgcgtc
cttcagggcgctctctctactttcgccaacaccagctccttcttctggacggtggccatc
gccctctacctatacctcagcatcgtccgaactacgcgcgggccctccacggaccaccta
atctgggcttttcacctcatcagctggggtgtcccgttggccatcacagtggcagccgtc
tctctaaagaagataggctatgatgcctcggatgtgtctgtgggctggtgctggatcaac
ctggaggctgaggaccgtgtcctgtggatgctactgaccgggaagctgtgggagatgctg
gcttatatcttgctacctctgctgtaccttttggtcagaaagcacatcaacagggcgcac
caggcgctctcggagtaccggcccatctgcgaggggcgccagctgcagcgaggctcctcc
acttccacggcagataagaagttggtcctcattccgctcatattcatctgcctccgcgtc
tggagcaccgtgcgctttgtcctgacgctctgtggttccccggctgtacagacacccgtg
ctggttgttctgcatggcattggaaacaccttccagggaggggccaactgcatcatgttc
gtcctctgtacccgggcagtccgcacaaggctcttttctctttgctgctgctgtcctcgg
ccctccacccagagccctccgggggctcctacgccccccaagataggagaatctcaggaa
tccagacggaccccagaagtgcccagcacttga

DBGET integrated database retrieval system