KEGG   Mus musculus (house mouse): 269623
Entry
269623            CDS       T01002                                 
Symbol
Rbm48, AW548102, C030048B08Rik
Name
(RefSeq) RNA binding motif protein 48
  KO
K24824  RNA-binding protein 48
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    269623 (Rbm48)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome associated proteins
    269623 (Rbm48)
SSDB
Other DBs
NCBI-GeneID: 269623
NCBI-ProteinID: NP_766579
MGI: 2442653
Ensembl: ENSMUSG00000040302
UniProt: Q8K2X2 H9H9R8
Position
5:complement(3633978..3648090)
AA seq 371 aa
MASSDGKPGGVFDHHVQTAVCDSRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGAMK
ELVERFALYGAIEQYNALDEYPAEDFTEVYLIKFVKLQSARVAKKKMDEQSFFGGLLHVC
YAPEFETVEETRKKLQERKAYITRVTKNQDCYMAKKKPVPEQKGTKDSRQGFHPPMPGFG
TAALNTSPESPPENSSSCLPYSCEFPLSCFASKSTCSRGEHVDRVSDSCNSARNHGELSR
HRDHSAFSPKLQMNTYKNSVPCSSVQEAIATSQAVGRFMPRTTQLQERKRRRDCDRELGT
LLETHTSSNEVLIGPKLPGIPTVDLQDDSLNTTATLIRRKLKEVISSVPKPPEDNIKDVC
TSHPGKQRRRI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcatccagtgacgggaaacctggtggcgtattcgatcaccacgtccagacggctgtg
tgtgactcgcgggccaaataccgggagggccgacgccctcgcgcggtcaaggtatataca
atcaatttggagtctcagtacttactaatacaaggagttcctgcagtgggagccatgaag
gaattagttgagcgttttgctctgtatggtgcgattgaacagtataacgctctagatgaa
tacccagcggaagattttacagaagtttatctcattaaatttgtgaaattacagagtgca
agggtagctaagaaaaagatggatgaacagagcttctttggagggttacttcatgtgtgc
tacgctccagaatttgagacagttgaagaaactagaaaaaaattacaagaaagaaaggct
tatattacaagagttactaaaaaccaagattgttacatggcgaagaagaaaccagttcca
gagcagaaaggaacaaaagattctagacaaggtttccatccacctatgcctggatttggt
acagctgctttaaacacatctcctgagagtcctccagagaactcgagttcttgtcttcct
tattcttgtgaattccctttaagctgttttgcttccaagagcacatgttcacgtggggaa
catgtggacagagtatcagactcctgtaatagtgctaggaaccatggtgaactgtctagg
catcgtgaccacagtgccttttcaccaaagctgcagatgaacacttacaaaaactccgtc
ccttgctctagtgtgcaagaggccattgctacctcacaggcagttggcaggttcatgcct
aggacaacacagctgcaggagaggaaacggcggcgagactgtgatcgagaactgggaact
ctgcttgagacacacacaagcagtaacgaggttttgattggacctaagttaccaggtatc
cccacagtagatctgcaggacgactccttgaatacaacggcaaccttaattcggaggaaa
cttaaagaggtgatttcatctgtgccaaagcctccagaggacaatataaaagacgtgtgt
acaagtcacccaggaaaacaaagaagaagaatatag

DBGET integrated database retrieval system