KEGG   Mus musculus (house mouse): 269629
Entry
269629            CDS       T01002                                 
Symbol
Lhfpl3, A930031L14Rik
Name
(RefSeq) lipoma HMGIC fusion partner-like 3
  KO
K23893  LHFPL tetraspan subfamily member protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    269629 (Lhfpl3)
   03037 Cilium and associated proteins [BR:mmu03037]
    269629 (Lhfpl3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   269629 (Lhfpl3)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   269629 (Lhfpl3)
SSDB
Motif
Pfam: L_HMGIC_fpl Claudin_2
Other DBs
NCBI-GeneID: 269629
NCBI-ProteinID: NP_084266
MGI: 1925076
Ensembl: ENSMUSG00000106379
UniProt: Q9CTN8
Position
5:22951052..23480595
AA seq 232 aa
MPGAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDG
VDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIV
CFTLFFFCNTATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGAC
SVRWAYILAIIGILDALILSFLAFVLGNRQDSLMAEELKAENKVLLSQYSLE
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcccggagccgccgccgccgccgccgcgatgctcccggctcaggaggctgccaagctg
taccacaccaactatgtgcggaactcgcgggccatcggcgtgctgtgggccatcttcacc
atctgctttgccatcgtcaatgtggtgtgcttcatccagccctactggatcggcgacggc
gtggacaccccgcaagccggctatttcgggctcttccactactgcatcggcaacggcttc
tcccgggagctgacctgcaggggtagcttcacggacttctccacgctgccctcgggcgcc
ttcaaagccgcctccttcttcatcggcctctccatgatgctcatcatcgcctgcatcgtt
tgctttaccctcttcttcttctgcaacacagccaccgtgtacaagatctgtgcttggatg
cagctcacctccgctgcctgccttgtccttggctgtatgattttccctgatggctgggat
tcagacgaagtaaaacggatgtgcggagagaagacagacaagtacactcttggggcctgc
tcggtccgctgggcgtacatcctggctatcatcggaatcttagacgccctgatcctctcg
tttctagcgtttgtgcttgggaaccgacaagacagcttgatggcagaggaactgaaagca
gaaaacaaagttctgttaagccaatattctctagaatga

DBGET integrated database retrieval system