KEGG   Mus musculus (house mouse): 269633
Entry
269633            CDS       T01002                                 
Symbol
Wdr86, 2810046M22Rik
Name
(RefSeq) WD repeat domain 86
  KO
K24756  WD repeat-containing protein 86
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    269633 (Wdr86)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   269633 (Wdr86)
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 Nup160 PQQ_3 WD40_like PQQ_2
Other DBs
NCBI-GeneID: 269633
NCBI-ProteinID: NP_001074910
MGI: 1915466
Ensembl: ENSMUSG00000055235
UniProt: D3Z757
Position
5:complement(24901898..24935696)
AA seq 380 aa
MGSSGSALRVCADHRGGINWLSLSPDGQRLLTGSEDGTARLWSTVDGQCCALLQGHESYV
TFCHLEDEAAFTCSADCTIRRWDVRTGQCLQVYRGHTSIVNRILVANDQLFSSSYDRTAR
VWTVDKGQVSQEFRGHRNCVLTLAYSAPEDLPQDPCMEAAMGGGLLVTGSSDDTAKVWQV
ASGCCHQTLRGHTGAVLCLVLHVSSHTAFTGSTDATVRAWDILSGEQLRVFREHQGSVIC
LELTDRLLYSGSADRTVKCWLADTGERVLTFPAHRHSVSALKYHAGTLFTGSGDACARAF
DAQSGVLQRVFRGHTFVINCLQVHGQVLYTASHDGALRLWDVRGLQSVPPLPRRPAAKRS
LSRLFSNKVACAAPVPLQPA
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggggagcagcgggtcggctctgagggtctgtgcggaccaccgcgggggcatcaactgg
ctgagcctgagccccgacgggcagcgcctgctgacgggcagcgaggacggcacagcccgc
ctctggagcaccgtggacggccagtgctgcgcgctccttcaaggacatgagagctatgtg
accttctgtcacctggaggatgaagctgccttcacctgtagtgctgactgcaccatccgg
aggtgggatgtgaggacggggcagtgtctgcaggtgtacagaggacacacatccattgtg
aacaggatcctagttgccaatgaccagctcttcagcagttcctatgatcggacagctcgt
gtgtggactgtggacaaagggcaagtgtcccaagagttccggggccaccgtaactgtgta
ctgacactagcctactctgctcccgaggacctgccccaagatccctgcatggaggcagcc
atgggtggtgggctcctagtgactggcagctcagatgacacagccaaagtgtggcaggta
gccagtggctgctgccaccagactcttcggggccacacaggtgcagtgctgtgcctggtg
ctgcatgtgtccagccacacagccttcacaggcagcactgatgccaccgttcgcgcttgg
gacatcctgagtggggagcagctgcgagttttccgggagcaccagggctctgtcatctgt
ttggagctcacagatcggctcctgtactcgggcagtgcggacagaactgtcaagtgctgg
ctagctgatactggggagagggtgctcacctttccagcacatagacacagcgtgagtgcc
ctcaagtaccacgcaggcaccttgttcacaggcagtggggatgcctgcgcccgggccttt
gatgcccagtcaggagtgctgcagagggtgttccgaggccacacctttgtcatcaactgt
ctccaggtgcacggccaggtgctctacacagcttctcatgatggtgctctgcgcctctgg
gacgtacgtggtctccagtcggtgccacctttgccacgcaggccagcagccaagcgtagc
ctctcacgcctctttagcaacaaggtggcctgtgcagccccagtgcccctacagccagcc
tga

DBGET integrated database retrieval system