KEGG   Mus musculus (mouse): 269642
Entry
269642            CDS       T01002                                 

Gene name
Nat8l, 1110038O08Rik, Sh, Shati
Definition
(RefSeq) N-acetyltransferase 8-like
  KO
K18309  aspartate N-acetyltransferase [EC:2.3.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    269642 (Nat8l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.17  aspartate N-acetyltransferase
     269642 (Nat8l)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_3 FR47 Acetyltransf_15 Acetyltransf_8 DUF2156 DUF898
Other DBs
NCBI-GeneID: 269642
NCBI-ProteinID: NP_001001985
MGI: 2447776
Ensembl: ENSMUSG00000048142
Vega: OTTMUSG00000055711
UniProt: Q3UGX3 A0A0R4J0R4
Position
5; 5 B2
AA seq 299 aa
MHCGPPDMVCETKIVATEDHEALPGAKKDALLVAAGAMWPPLPAAPGPAAAPPPAAGPQP
HGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYAL
LAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSC
FWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSA
VVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcattgtgggcctcccgacatggtctgcgagacgaagatcgtggctacggaggaccat
gaggcactgccgggggccaagaaggacgcgctgctcgtcgccgccggagccatgtggccc
ccgctgcccgccgcgcccgggccggccgccgcacccccacccgcggcaggtccccagccc
cacggaggcaccgggggcgcggggccgccggaggggcgcggcgtgtgcatccgcgagttc
cgcgcagccgagcaggaggcggcgcgccgcatcttctacgacggcatcttggagcgcatc
cccaacacggctttccgcggcctgcggcagcacccgcgcacccaactgctctacgccctg
ctggccgccctctgttttgctgtgacccgctcactgctgctgacatgcctggtgccggcc
gggctcctggccctgcgctactactacagccgcaaggtgattctggcctacctggagtgt
gcgctgcacacggacatggctgacattgagcagtactacatgaagccacctggttcctgt
ttctgggtggctgtgctggacggcaacgttgtgggcatcgtggccgcacgggcccatgag
gaggacaacacagtggagctgctccgcatgtccgtggactcgcgtttccgcggaaaaggc
atcgccaaggctctgggcaggagggtgttggagtttgccatgctgcacaactactctgca
gtggtactgggcaccacagccgttaaggtggccgcccacaagctctatgagtcactgggc
ttcagacacatgggcgcgagtgatcactacgtgctgcctggcatgaccctctcgctggcc
gagcgcctcttcttccaggtccgctaccaccgctaccgcctgcagctgcgcgaggagtga

DBGET integrated database retrieval system