KEGG   Mus musculus (mouse): 26965
Entry
26965             CDS       T01002                                 

Gene name
Cul1, Cul-1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04710  Circadian rhythm
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26965 (Cul1)
   04120 Ubiquitin mediated proteolysis
    26965 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    26965 (Cul1)
   04340 Hedgehog signaling pathway
    26965 (Cul1)
   04350 TGF-beta signaling pathway
    26965 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    26965 (Cul1)
   04114 Oocyte meiosis
    26965 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    26965 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26965 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26965 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    26965 (Cul1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     26965 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 26965
NCBI-ProteinID: NP_036172
MGI: 1349658
Ensembl: ENSMUSG00000029686
Vega: OTTMUSG00000022333
UniProt: Q9WTX6
Position
6; 6 B2.3
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatcctcatggactgaagcagattggtcttgaccagatc
tgggatgacctcagagctggaattcagcaggtgtataccagacaaagcatggcaaagtcc
agatacatggaactctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggtgctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgttggcttggagttatacaagcgattgaaggaatttttgaagaattatttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtcctgaagttctacact
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgccgtgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgttttaaagttgattgaaaaggaaagaaatggagaaaccatcaatacaagactg
attagtggagttgtacaatcttatgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttacagcagaacccagttactgaatat
atgaaaaaggctgaagctcgtttgcttgaggaacagcggagagttcaggtttacctccac
gagagcacacaagatgaactagcacggaaatgtgagcaggtcctcattgaaaaacacttg
gaaatttttcacacagagtttcagaatttattggatgctgacaagaatgaagatttgggc
cgcatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gagacacatattcataatcagggtcttgcagcaattgagaagtgtggagaagctgctcta
aatgaccccaagatgtatgtgcagacagtgctggatgttcataaaaaatacaatgccctg
gtgatgtcagcattcaacaacgatgctggcttcgtagctgctcttgataaggcttgtggt
cgcttcataaacaacaatgcggttaccaaaatggcccagtcatccagtaaatcccctgag
ctgcttgctcggtactgtgactccttgctgaagaaaagttccaagaacccagaagaggca
gaactagaagacaccctcaatcaagtgatggtggtcttcaagtacatcgaggacaaagat
gtatttcagaagttctatgcaaagatgcttgccaagagactggtacatcaaaacagtgcg
agtgacgatgctgaagcaagcatgatctccaagttaaagcaagcttgtggttttgagtac
acttccaaacttcagcgaatgtttcaagacattggtgtaagcaaagatctgaatgaacag
ttcaaaaaacacctgacgaattcagaaccgctggacttggacttcagtattcaggtcctg
agttctggatcgtggccctttcagcagtcttgcacgtttgccttgccgtcagagttggag
cgcagttatcagcgatttacagctttctacgccagccgtcacagtggcagaaaattgaca
tggttgtatcaactgtccaaaggggaactagtcactaactgcttcaaaaacagatacact
ttgcaggcgtccacatttcagatggcaatcctgcttcagtataacacagaagacgcctat
actgtgcagcagttgactgacagcactcagattaaaatggacattttggcacaagtccta
cagattttactgaagtcgaaattgctggtcttagaagatgaaaatgccaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaattg
agggttaatatcaatgtaccaatgaaaactgaacagaagcaggaacaagaaactacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaaa
atgaggaaggtcctgaaacaccagcagttacttggtgaagtcctcactcagctctcctcc
aggttcaaacctcgggtcccggtgatcaagaaatgcattgatattctcatcgaaaaagaa
tatttggagcgagtcgatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system