KEGG   Mus musculus (house mouse): 26968
Entry
26968             CDS       T01002                                 
Symbol
Islr, Meflin
Name
(RefSeq) immunoglobulin superfamily containing leucine-rich repeat
  KO
K25566  immunoglobulin superfamily containing leucine-rich repeat protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    26968 (Islr)
SSDB
Motif
Pfam: LRR_8 LRR_4 I-set LRR_9 Ig_3 LRR_5 ig LRRCT_2 LRRCT Ig_2 SAM_3 LRR_6
Other DBs
NCBI-GeneID: 26968
NCBI-ProteinID: NP_001182360
MGI: 1349645
Ensembl: ENSMUSG00000037206
UniProt: Q6GU68 A0A146E664
Position
9:complement(58063547..58066563)
AA seq 428 aa
MRALCLLCWAVLLNLVRACPEPCDCGEKYGFQIADCAYRDLEGVPPGFPANVTTLSLSAN
RLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLLSEFAWSDLHN
LSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALAEGTFAPLTALSHLQINDN
PFDCTCGIVWFKTWALASAVSIPEQDNIACTTPHVLKGIPLGRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPVPQLHWHIHTPGGTVEIASPNVGTDGRALPGALATSG
QPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVNVALATPGEGGEDAVGHKFH
GKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGPPEAAIAADGRPAQQFSGILLLGQSL
LVLSFFYF
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcgggcactgtgcctgctttgttgggctgttctcctgaacctggtgcgagcttgtcca
gagccctgtgactgtggggagaagtatggcttccagattgcagactgtgcctatcgtgac
ctagagggtgtgccaccgggcttcccggccaatgtgaccacactgagcctgtcagccaac
aggctgccaggcctgccggagggagccttcagggaagtgcccctattgcagtcgctgtgg
ctggcacacaatgagatccgctcggtggctattggtgctctggcccctctgagccatctc
aagagtctggacctcagccacaacctcctctctgagtttgcctggagcgacctgcacaac
ctcagcgctctgcagctgctcaagatggacagcaacgagttagccttcatccctcgggac
gcctttagcagcctcagcgccctgcgttccctgcagctcaaccacaaccgcctgcacgcg
ttggccgagggcaccttcgcaccgctcaccgcgctgtcccacttgcagatcaatgacaac
cctttcgactgcacctgtggcatcgtgtggttcaagacatgggccctggcctcagcggtg
tctattccagaacaggacaacattgcctgtactacaccccacgtcctgaagggtatccca
ctaggccgcctgccacccctgccctgctcagctccctcagtgcaactaagctaccagccc
agccaagatggagcagagctacggcctggcttcgtgctggcactccactgtgacgtggat
ggacagccagtcccccagctccattggcacattcacaccccgggcggcacggtggagatc
gccagtcctaatgtaggcactgatggacgtgccctgcctggtgcccttgcaaccagtggg
cagccacgcttccaggcctttgccaatggcagcctgcttatccctgactttggcaagctg
gaggagggcacctatagctgcctggccaccaatgagctaggcagtgccgaaagctctgta
aatgtggcattggccaccccaggtgaggggggagaggatgctgtggggcacaagttccat
ggcaaagcagtggagggcaagggctgctatacggttgacaacgaggtacagccatccgga
ccggaagacaacgtggttatcatttacctcagccgtgctgggcccccagaagctgcaata
gcagcagacgggaggcctgcgcagcagttctctggcatacttctgctaggccaaagcctg
cttgttctctcctttttctacttctaa

DBGET integrated database retrieval system