KEGG   Mus musculus (mouse): 269693Help
Entry
269693            CDS       T01002                                 

Gene name
Ccdc60, AU018954, C130098D09
Definition
(RefSeq) coiled-coil domain containing 60
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4698
Motif
Other DBs
NCBI-GeneID: 269693
NCBI-ProteinID: NP_808427
MGI: 2141043
Ensembl: ENSMUSG00000043913
Vega: OTTMUSG00000014688
UniProt: Q8C4J0
Position
5; 5 F
AA seq 545 aa AA seqDB search
MTKVPATKKLQKITSKKALWLFSSADQLTQQASDKTAKNSKYIDKEIANLKKDLMRSRFL
IQCVKIGRGYFNILREENAMKKKQQLLQKLKEEELNKFQPAKKFSDIHCRDNLLATYDCE
KLKKLEAGIIIRPFTPIHSCLMAPSLPESHVDPLFRQLCALHWLLEALTIDHTHHTMRPL
IACWNPKDPGGSKSTIKKINKDKSMGQRWDHFVTAPKTKKYKAPAIRTAMASRKPSRRGS
TLSLTRTSGGSSPQSSMMSVNPGSDEPMGSKDIEDNESSSTKPEEEILHLYLQKLLEMVR
EDARRTILVESEIQKKAPSILSLVKQIKSEYGWKEWQTTHKSSERSSTTSAESHIQVIQK
KSKSRVNRDIIYCKTGVCSNMRAKFFSVAQEAGFCLQDKMEILRKRQEERGLQKFHSFIV
TSNFQKDITKMRHQVSIVKGDAEEIADHWYFDLLSKLPEDLKSFRPAKKILMKLQKFGEN
LDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYINWLQSRVNIPFRQ
RTILT
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtgccagccaccaaaaagttacaaaaaatcaccagcaagaaggccctttgg
ctcttttccagcgcagatcaactgactcagcaggcctcagacaagacagcgaagaactcc
aaatatatagacaaggagatagcaaaccttaagaaggatcttatgcgaagccgcttcctg
atccagtgtgtgaagataggccgaggctacttcaacatcctgcgagaggaaaatgccatg
aaaaagaagcagcagctactccagaagctgaaggaggaggagctaaacaagttccagccg
gccaagaagttctcagatatccactgcagggacaacctgctggctacctacgactgtgag
aagctaaagaagttggaggccgggatcatcatccgcccgttcacgcccatccacagctgt
ctcatggcgccctccctgcctgagtctcacgtggatccgctcttccgccagctgtgtgct
ctccactggctcctagaggccctgaccatcgaccacacccaccacaccatgaggcccttg
attgcctgttggaaccccaaggacccaggtggcagcaagagcacaataaagaagattaac
aaggacaagtccatggggcagaggtgggatcacttcgtcacggcacccaagaccaagaaa
tacaaagctcccgccatccgcacagccatggccagccgcaagcccagcagacgaggctct
accctcagcctgactcggaccagtgggggctcttctccccagagcagtatgatgtcagtg
aaccccggctccgatgagcccatgggcagcaaagacatcgaagacaatgagtcctcctcc
actaagccagaagaggaaatcctccacctctacttgcagaagctgctggagatggtccgg
gaagacgcccgaagaaccatcttggtggagagcgagatacagaagaaagcccccagcatc
ctgtctttagtcaagcaaatcaagagtgagtatggatggaaggagtggcagaccacacac
aaatccagcgagcggtccagcactacaagcgcagagagccacatccaggtgatccagaag
aagtcgaagagcagagttaaccgtgacatcatctattgcaagaccggggtgtgtagcaac
atgcgggccaagtttttcagcgtagcccaggaggccggcttctgcctgcaggacaagatg
gaaatcctcaggaagcgccaggaggagcgaggactccagaagttccactccttcattgtc
acctcgaacttccagaaggacataacaaagatgaggcaccaggtctccatagtgaaaggg
gacgcagaggagattgccgaccactggtacttcgatctgctgtccaaactccctgaggat
ctgaagagcttccggcctgccaaaaagatcctgatgaagctgcagaagtttggagagaac
ctggacctgaggatccggccccacgtcctcctgaaggtgctccaggacctgcggatctgg
gagctgtgttccccggacattgcagtggccattgagtttgtgagagaacacattattcat
atgccccaggaagactacatcaactggctacagagccgagtcaacattcccttccggcag
cgcaccatcctgacatag

DBGET integrated database retrieval system