KEGG   Mus musculus (mouse): 269717Help
Entry
269717            CDS       T01002                                 

Gene name
Orai2, A730041O15Rik, Tmem142b
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 2
  KO
K16057  calcium release-activated calcium channel protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    269717 (Orai2)
Ion channels [BR:mmu04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   269717 (Orai2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orai-1 DUF4199 DUF2207
Motif
Other DBs
NCBI-GeneID: 269717
NCBI-ProteinID: NP_848866
MGI: 2443195
Ensembl: ENSMUSG00000039747
Vega: OTTMUSG00000054379
UniProt: Q8BH10 Q14BR6
Position
5; 5 G2
AA seq 250 aa AA seqDB search
MSAELNVPMDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKL
KASSRTSALLSGFAMVAMVEVQLETKYQYPQPLLIAFSACTTVLVAVHLFALLISTCILP
NVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDAKD
QPGSHSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKLKVQL
DGHERSLQVV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagagctcaatgtgcccatggacccctctgcccctgcctgccctgaacccggc
cacaagggcatggattaccgagactgggtccggcgcagctacctggaactcgtcacgtct
aaccaccattcggtgcaggcactgtcctggaggaagctctacctgagcagggccaagctg
aaagcctccagccggacctcagccctcctgtctggcttcgccatggtggccatggtggag
gtgcagctggagaccaagtaccagtaccctcagcccctgctcattgccttcagcgcctgc
accacggtgctggtagccgtgcatctgtttgctctgctcatcagcacttgcatcctgccc
aacgtggaagcggtgagcaacatccacaacctcaactccatcagcgagtcgccgcacgag
cgcatgcacccgtacatcgagctggcctggggcttctccaccgttctgggcatcctgctt
ttcctggctgaggtggtcctgctctgctggatcaagttcctcccagtggatgccaaggat
cagccaggctcccacagccacacgggctggcaggccgctctggtgtccaccatcatcatg
gtacctgtgggtctcatcttcgtggtcttcaccatccacttctaccgttccctggtgcgg
cacaagacggagcgccacaaccgtgagatcgaagagctgcacaagctcaaggtgcagctg
gatgggcacgagcggagcctgcaggtggtgtga

DBGET integrated database retrieval system