KEGG   Mus musculus (mouse): 269774Help
Entry
269774            CDS       T01002                                 

Gene name
Aak1, 5530400K14Rik, 9630042K20, AU067724, AU067726, BC028270, C79663, D6Ertd245e, R75501, mKIAA1048
Definition
(RefSeq) AP2 associated kinase 1
  KO
K08853  AP2-associated kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    269774 (Aak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    269774 (Aak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     269774 (Aak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   269774 (Aak1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    269774 (Aak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 269774
NCBI-ProteinID: NP_001035195
MGI: 1098687
Ensembl: ENSMUSG00000057230
Vega: OTTMUSG00000024486
UniProt: Q3UHJ0
Position
6 D1; 6 37.75 cM
AA seq 959 aa AA seqDB search
MKKFFDSRREQGSSGLGSGSSGGGGSSSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFALV
FLVRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQAEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGSFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPVPNVQNSPIPAKLPEPVKASEAAVKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPLPQAAGPSNQPGLLPSVSQPKA
QATPSQPLQSSQPKQPQAPPTPQQTPATQTQGLPTQAQATPQHQQQHLLKQQQQQQQQPQ
QPTAPPQPAGTFYQQQQQQQQQQAQTQQFQAVHPAAQQPVTAQFPVGSQGGAQQQLMQNF
YHQQQQQQQQQQQLMAQQAALQQKTAVVVPQSQAQPATAPQAAAAQEPGQIQAPVRQQPK
VQTTPPPTIQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAAAE
ASLNKSKSATTTPSGSPRTSQQNVSNASEGSTWNPFDDDNFSKLTAEELLNKDFAKLGEG
KLPEKLGGSAESLIPGFQPTQGDAFTTPSFSAGTAEKRKGGQAVDSGIPLLSVSDPFIPL
QVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIDKADVAVESLIPGLEPPVAQ
RLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTAGLLEEFAPIALSAPTHKAAEDSNLIS
GFGVAEGSEKVAEDEFDPIPVLITKNTQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttttcgactccaggcgggagcaggggagctctggcctgggttcaggctcc
agcggaggagggggcagcagctcaggcctgggcagtggttacatcggaagggtcttcggc
atcgggaggcagcaggtcaccgtggacgaggtgttggcggaaggtggattcgctcttgtc
tttctggtgagaacaagcaatggggtgaaatgtgccttgaaacgtatgtttgtcaacaat
gaacatgacctccaggtgtgcaagagggagatccagatcatgagagacctatcagggcac
aagaacattgtgggctacattgattctagtatcaacaatgtgagcagcggcgacgtctgg
gaagttctcattctcatggacttctgcagaggaggccaggtggtaaacctgatgaaccag
cgtctccagacaggcttcacagagaatgaagtgctgcagatattctgtgacacctgtgaa
gctgtggcccgcctgcatcagtgcaaaactcccattatccaccgggacctgaaggttgaa
aatatcctcttgcatgaccgaggccactatgtcttgtgtgactttggaagtgccaccaac
aaattccagaatccacaggccgagggagtcaatgcagtagaagatgagattaagaaatac
acaacgctctcctatcgagccccagaaatggtcaacttgtacagtggcaaaatcatcact
acgaaggcagatatttgggctctaggctgtttgttgtataaattatgctacttcactttg
ccgtttggggagagccaggtggcgatttgtgacggaagcttcacaattcctgataactct
cgttattctcaagatatgcactgccttattaggtatatgttggaaccagaccctgacaaa
aggccggatatttaccaggtttcatacttctcatttaaactactcaagaaagaatgcccc
gttccaaatgtacagaactctcccattcctgcaaaacttcctgaaccagtgaaagccagt
gaagcagctgtgaaaaagacccagccaaaggccagactgaccgatcccattcccaccaca
gagacttcaatcgcaccccgccagaggcctaaagctgggcagactcagccaaacccaggc
atccttcccatccagccagccctgactcctcggaagagggccactgttcagcccctacct
caggctgcaggacccagcaatcagcctggacttctacccagtgtttcccaacctaaagcc
caagccacacccagtcaacctcttcagtcatctcaacccaagcaaccacaagctccaccc
accccacagcagacacctgctacccagacacaaggtttgcccacccaggcccaggccact
ccccagcaccagcagcaacacctcctcaagcaacagcagcaacagcagcaacagcctcag
cagcctacagcaccaccacagcctgcaggcaccttttaccagcagcagcagcaacagcag
cagcagcaggctcagactcagcagtttcaggcagtacatccagcagcccagcaaccagtc
actgctcagttccctgtggggtcccagggaggtgctcagcaacagctgatgcagaacttc
taccaccagcagcaacagcagcagcagcagcagcagcagctgatggctcagcaggctgcc
ctgcagcagaagactgctgtggtagtaccacagtctcaggcacagcccgccacagcccca
caggcagctgctgcccaggagcctgggcagattcaagccccagtgagacaacagccaaaa
gttcagaccactccacctccaaccatccagggacagaaagttggatctctcactcctcca
tcatcacccaaaacccaacgtgctgggcacagacggattctcagtgatgtaacccacagt
gcagtctttggggttcctgccagcaaatcaacccagctgctccaggcagctgcagctgag
gccagtctcaataaatctaagtctgcaaccaccactccctcaggctctccacggacttca
cagcagaatgtctccaatgcttcagaaggctccacatggaatccttttgatgacgacaac
ttctccaaactcacagctgaagagctgctaaacaaggactttgccaagcttggggaagga
aagctgcctgagaagcttggtggctctgcagagagtttgatcccaggcttccagccaaca
caaggagatgccttcaccactccttctttttctgctggaactgctgaaaaaaggaagggg
ggccaggctgtggactctggcatcccacttctaagtgtgtctgatcccttcattcctctt
caagtacctgatgctccagaaaaactaatcgagggactcaaatctcctgacacttctctt
ctgctccctgacctcttgcctatgacagatccttttggcagcacttctgatgctgttatt
gacaaagctgatgttgctgttgagagtctcatacctggactggagccacctgttgctcag
cgcctcccatctcaaacggaatctgtgacctcgaaccgcacagactctctcacgggggaa
gactctctgcttgactgctctctgctttctaaccctactgctggccttctggaggagttt
gcccccatagcactctctgctcccactcataaagctgcagaagatagcaatctcatctca
ggttttggtgttgctgagggctccgaaaaggtggcagaagatgagtttgaccctattcct
gtactaattaccaaaaacacacaaggtgggcactctaggaacagcagtgggagctctgag
tccagtcttcccaacctagccaggtctttgctgctggtggatcagctcatagacctgtag

DBGET integrated database retrieval system