KEGG   Mus musculus (mouse): 269784Help
Entry
269784            CDS       T01002                                 

Gene name
Cntn4, 9630050B05, Axcam, BIG-2
Definition
(RefSeq) contactin 4
  KO
K06762  contactin 4
Organism
mmu  Mus musculus (mouse)
Brite
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Contactins
   269784 (Cntn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Adeno_E3_CR1 Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 269784
NCBI-ProteinID: NP_001103219
MGI: 1095737
Ensembl: ENSMUSG00000064293
Vega: OTTMUSG00000024598
UniProt: Q69Z26
Structure
PDB: 

Position
6; 6 E1
AA seq 1026 aa AA seqDB search
MRLPWELLVLQSFMLCLADDYTLHGPVFVQEPSHVMFPLDSEEKKVKLSCEVKGNPKPHI
RWKINGTDVDIGMDFRYSVVDGSLLINNPNKTQDAGTYQCIATNSFGTIVSREAKLQFAY
LENFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPAEKG
TTVKLECFALGNPVPTILWRRADGKPIARKARRHKSNGILEIPNFQQEDAGSYECVAENS
RGKNVAKGQLTFYAQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPLLTRD
RIQIEQGTLNITIVNLSDAGMYQCVAENKHGVIFSSAELSVIAESPDFSRTLLKRVTLVK
VGGEVVIECKPKASPRPVYTWRKGREILRENERITISEDGNLRIINVTKSDAGSYTCIAT
NHFGTASSTGNVIVKDPTKVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFNGHLI
DFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVNTVPDLVDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVF
NNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKY
WRHDDKEENAKKIRTVGNQTSTKITNLKGSALYHLSVKAYNSAGTGPSSATVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNSYARGSGASTSNACTLSAISTIMISL
TARSSL
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccatgggaactgctagtgctgcaatcattcatgttgtgccttgcagatgac
tacacactgcatggcccagtttttgttcaagaaccaagtcatgtcatgtttcctttggat
tctgaggagaaaaaagtgaaactcagttgtgaagttaaagggaatccaaaacctcacatc
aggtggaagataaatggaacagatgttgacattggtatggatttccgctacagtgttgtt
gacggcagcttgttgatcaataaccccaataaaacccaagatgctggaacgtaccagtgc
atagcaacaaactcatttggaacaattgtaagcagagaagcaaagcttcagtttgcttat
cttgaaaactttaagacaagaacaagaagcactgtgtcagtccgtcgaggtcagggaatg
gtccttctgtgcggcccgccaccccattctggagagctgagctatgcctggatcttcaat
gaatacccttcctatcaggataaccgccgcttcgtttctcaagagactgggaatctgtat
attgccaaagtggaaaaatctgatgttggtaattacacctgtgtagttaccaacactgtg
accaaccacaaggtcctgggaccgcccacaccactaatcctgagaaatgatggggtgatg
ggtgaatatgagcccaaaatagaagtacagtttccagaaaccgtcccggctgagaaagga
acaacagtcaaactggaatgctttgccttaggaaatccagtcccaactattctatggcga
agagctgatggcaagccaatagcaaggaaagccagaagacataagtcgaatggaattctg
gaaattcccaattttcagcaggaagatgccggttcatatgaatgtgtggctgaaaactcc
agaggcaaaaacgtagccaagggacagttgactttttatgctcaacctaactgggttcaa
ataataaatgatatccacgtggccatggaagagagtgtcttctgggaatgtaaagcaaat
gggaggcctaaacctacctacagatggctaaaaaatggtgacccactgttaacacgggat
agaatacaaatcgagcaaggaacactcaacataacaatagtgaatctctcagatgctggc
atgtaccagtgtgtggcagaaaataaacatggagttatcttttccagcgctgagcttagt
gtaatagctgaaagtccagatttttcccgaacactcttaaaaagagtaacacttgtcaaa
gtgggaggtgaagttgtcattgagtgcaagccaaaagcatccccaagacctgtctacacc
tggagaaagggaagagaaatattaagagaaaatgaaagaattaccatttctgaagatggg
aacctcagaatcatcaatgtgactaaatctgatgctggaagttacacctgcatagccacg
aaccattttggaactgccagcagtactgggaatgtgattgtgaaagacccaacaaaggtg
atggttcctccttccagcatggatgtcactgtaggagaaagcattgttcttccatgccag
gtaacacatgatcactccctggacattgtgtttacgtggacatttaatggacacttgata
gactttgacaaggatggagaccactttgaaagagttggagggcaggattcagctggtgat
ttgatgatccgaaacatccaactgaagcatgctgggaagtatgtctgcatggtccaaaca
agtgtagacaaactctctgttgctgcggacctgattgtaagaggtcctccaggtcctcct
gaggctgtgaccatagatgaaatcacagacaccactgctcagctttcttggagaccagga
cctgacaaccacagccccatcaccatgtatgttatccaagctaggactccattctccgtg
ggctggcaagcagtcaatacagttccagatctcgtcgacgggaagacattcacagcaact
gtggtgggtttgaatccttgggttgaatatgaattccgcactgttgcagctaatgtgatt
ggcattggggaacccagccggccctcagagaaacggaggacagaagaggctctccctgaa
gtcaccccggctaacgtcagtggtggtggaggcagcaaatctgaactggttataacctgg
gagacagtccctgaggaattacagaatggcagaggctttggttacgtggttgccttccgg
ccacatggcaaaatgatctggatgctgaccgtgctggcttcagctgatgcctccagatac
gtgttcaggaatgagagtgtgcgtccattctctccctttgaggttaaagtgggtgtcttc
aataacaaaggggaaggccctttcagtcccaccacgctggtgtattctgctgaagaagaa
cccaccaagccaccagccagtatctttgccaggagtctttctgccacggatatcgaagtt
ttctgggcctcccctattggaaagaacagaggacggattcaaggttatgaggtaaaatat
tggagacatgatgacaaggaagaaaatgctaaaaagatacgaacagttggaaatcagaca
tccacaaaaatcaccaacttgaaaggaagtgctctgtatcacttatctgtcaaggcgtat
aactcagctgggacaggaccctccagtgcaacagtcaatgtcacgaccagaaagccacca
ccaagccaaccccctggaaacatcatatggaattcatcggactccaaaattatcctgaac
tgggatcaagtgaaggccctggataatgagtcagaagtaaaaggatacaaagtcttgtac
agatggaacaggcaaagcagcacatctgtcattgaaaccaacaagacatcagtggagctt
tcattacctttcgatgaagattacatcatagagatcaagccattcagtgatggaggagat
ggcagcagcagtgagcaaatccgaatcccaaagatatcaaattcctatgcaagaggatcg
ggggcttctacctccaatgcgtgtacgctgtcagccatcagtacaataatgatttctctc
acagccaggtctagtttatga

DBGET integrated database retrieval system