KEGG   Mus musculus (mouse): 269959Help
Entry
269959            CDS       T01002                                 

Gene name
Adamtsl3, 9230119C12Rik, C130057K09, mKIAA1233
Definition
(RefSeq) ADAMTS-like 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 Ig_3 I-set Ig_2 ig PLAC V-set Ig_4
Motif
Other DBs
NCBI-GeneID: 269959
NCBI-ProteinID: NP_001177303
MGI: 3028499
Ensembl: ENSMUSG00000070469
Vega: OTTMUSG00000038092
UniProt: G3UXC7
Position
7; 7 D3
AA seq 1706 aa AA seqDB search
MAVRETPMILDPMASWTGSWWLLTRMIFTVSGLLQATAEKSPGAYFLPEFALSPQGSFLE
DTTGEQFLTYRYDDQTSRNAHSEEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNC
EGQNIRYKTCSNHDCPADAEDFRAQQCSAYNDVQYQGHYYEWIPLYNDPAAPCALKCHAR
GQSLVVELAPKVLDGTRCNADSLDMCISGICQIVGCDRQLGSNAKEDNCGVCAGDGSTCR
LVRGQTKMHLSPEKKEENVIAVPLGSRSVRITVKGPALIFIESKTLQGSRGEHSFNSPGV
FTVENTTIEFQKGADRQTFKIAGPLMADFIFKTRYTVAKGSVVQFFFYQPISHQWRQTDF
FPCTVTCGGGYQLNSAECMDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFK
EIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKCMYAPKP
TVMQACNLFDCPKWVAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQMKLHIKEEC
VIPIPCYKPREKSPVEAKLPWLKQAQELEETRIATEEPKFIPEPWSACSTTCGPGIQVRE
VRCRVLLTFTQTEAELPEEECEGPKPPTDRPCLRQACDQSPVSRELGGRLQEKDSEMTYD
WEYAGFTPCTATCLGGHQEAIAVCLHTQTHQTVNDSLCDTVHRPPPMSQACNMEPCPPRW
HMGSWGACSATCGVGIQTRDVYCLHPEEFPAPPEECREEKPHALRACNQFDCPPSWHIEE
WQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPQLAAGD
WSKCSVTCGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLVRPCQMPICSKAKLGT
KTKLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWE
KDGHCLKNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIAHPS
LREHVRGHPGVDHNEANSLGATWHKMRQMWNNKNDLYLHGGEMNKQPFLRALFGPCRTSE
GNDNSWEFKNKQFEAAMKQGAYSMDTAQFDELIRNMSQLMEMGEASDDLASQMIYQLVAE
LAKAQPTPVQWRGIREEVAPEAQLRGKTERVPKNPTVKNSGKLTFKPKGPVLMRQILPPS
VSFNKTINARIGNTVYITKSTEIINILCSLITPSKEATYTWTKDGALLQPSVKIILDETG
KMQIRNPTRKEQGIYECSVASHLGSDVESSLVLYAEAPVILSIERNVTKPEHNHLSVVVG
GTVEAALQANVTIHCPVKGVPQPNVTWLKTGGSLSDNVSLLFNGSLLLQSASLENEGTYI
CTATNALGKAVATSGLRLLERREPGGKAAFPKVQKTRVLQAPRSRINSNNLTGKSLPQEH
FWEPGNWTHCSATCGPLGFRLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDCPAR
WFTSMWSECSASCGEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQ
QAIDPGNQCPGRCMGHATRMQHHHTACSHNSSSSDCEDGRRPAFGRNCTLGPCEACWRVG
PWKPCTAVCGRGFQSRKVDCIHTGSCKIVADRYCVQVKPAAWRHCLGPSCDRNCTDTTHY
CMFVKHLNLCSLAVYRQRCCQSCQEG
NT seq 5121 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagggagactcctatgatattggaccccatggcttcctggacaggatcctgg
tggctgctgacacgaatgatctttacggtctctggtcttctgcaggctacagcagagaag
tctcctggagcctacttccttcctgagtttgcgctctctcctcagggaagcttcctagaa
gacaccacaggggagcagttcctcacataccgctatgatgaccagacttcaagaaatgct
cattcagaagaagacaaggatggcaactgggacgcctggggagactggagtgactgctcc
cggacctgtggcggaggagcctcctattctttgcggagatgtctgactggaaggaactgc
gaaggacagaacatcagatacaagacttgcagcaatcacgactgcccagcagatgcagaa
gacttcagagcccagcagtgctcagcctacaatgacgtgcagtaccagggtcattattat
gaatggattccactatacaatgaccctgctgccccatgtgcactcaagtgtcacgctcgg
ggacagagtttggtggtagagctggcacccaaagtgttggatggaactcgctgcaatgct
gactctctggatatgtgcataagtggcatctgccagattgtgggctgtgatagacagctg
ggaagtaatgccaaggaggacaattgtggcgtctgtgctggggacggctccacctgcagg
ctggtgcggggtcagaccaagatgcacctgtctcctgagaagaaggaagaaaatgtgatt
gccgttcccttgggaagtcgaagtgtgaggattacggtgaaaggacctgccctgatcttt
attgagtccaaaacacttcaaggaagcagaggagagcacagcttcaacagtcctggggtt
ttcactgtagaaaacacgacgattgagtttcagaagggtgcggacagacaaaccttcaag
attgcgggacccctgatggctgatttcatcttcaagaccaggtacaccgtggccaaaggc
agcgtggtccagttcttcttttaccagcccatcagccatcagtggagacagactgacttc
tttccctgcaccgtgacatgtggaggaggttatcagctcaactctgctgagtgcatggac
atccgcttgaaaagggtagtgcctgaccactattgccattactacccagaaaatgtgaag
cctaaaccaaagctgaaggaatgcagtatggatccttgcccatccagtgatggatttaaa
gagattatgccctacgaccacttccaacctctccctcgctgggaacataatccctggact
gcatgttcggtgtcctgtggaggagggattcagagacggagttttgtgtgtgtggaggaa
tctatgcatgcagagattctacaagtggaagaatggaagtgcatgtatgcacccaagccc
acggtgatgcaggcttgcaacctctttgattgccccaagtgggttgccatggagtggtct
cagtgcacagtgacttgtggccgagggttgcgctaccgagtggttctgtgtatcaaccat
cgtgggcaacatgttggaggctgcaacccacagatgaagctgcacatcaaagaggagtgt
gtcatccccatcccgtgctataagcccagagaaaaaagtccagtggaagctaaattacct
tggctgaaacaagcacaagagctagaagagaccagaatagccacagaagaaccaaagttc
atcccagagccctggtcagcctgcagcaccacgtgcgggcctggcattcaggttcgtgag
gtgcggtgtcgggtgctcctcacgttcacacagacggaggctgagctccctgaggaggag
tgtgaaggccccaagccacccactgaccgaccctgcctccgtcaagcctgtgaccagagc
cctgtgtctcgagaactgggtggccgtctccaagagaaggacagtgagatgacttacgac
tgggagtacgctggctttaccccctgcactgcaacatgtttgggaggccatcaagaagcc
attgctgtgtgtttacacacccagactcatcagaccgtcaatgacagcctgtgtgacaca
gttcaccgtcctccaccaatgagtcaggcctgtaacatggagccctgcccgcccagatgg
cacatgggctcttggggagcctgttcagctacctgtggtgttggaatccagacacgagat
gtatactgcctccatcctgaggaattcccagcccctccggaggaatgcagagaggaaaag
ccgcatgccttacgagcgtgcaatcagtttgattgccctcccagctggcacatcgaagag
tggcagcagtgttccaggacatgcggtgggggaactcagaaccggagagtcacctgtcga
cagctgttaactgatggcagctttttgaatttgtcggatgagctgtgccaaggacccaag
gcatcgtctcataagtcctgtgccaggacagactgccccccacagctggctgccggagac
tggtcgaagtgctctgtcacctgcggggttggattccagagaagaaagcaggtgtgtcaa
aaactgactgccaaaggccgaagagtctccgtagctgagacgctgtgcagggacctgcca
gggctccccctcgtgagaccatgccagatgcctatatgcagcaaagcgaaactgggaacg
aagacaaaacttggagagaggggcccccagattcttggtgtccgcagagtctatatccag
acgagggaagagaagaggatcaacctgactgttggcagtagagcctacttgctgctcaat
acatctgtgatcatcaaatgcccagtgcgacgcttccagaagtctctaatccagtgggag
aaggatggccattgtctgaagaactctaagcagcttggcatcaccaagtcaggttcactg
aaaatccatagccttgctgcccctgacattggtgtatacagatgcatcgcaggctctgca
caggagacggtcgttctcaagctcattgggactgacaaccgactcatcgcacacccgtcc
ctacgagagcacgtgaggggtcaccctggggtggaccataatgaagccaatagtttggga
gccacatggcataaaatgcgccagatgtggaataacaaaaatgatctttatctgcacggt
ggtgaaatgaataagcagcctttcttaagagccctgttcgggccgtgccggacctctgaa
ggaaatgataactcctgggagtttaagaacaagcagtttgaagcagccatgaaacaggga
gcatacagcatggacacagcccaatttgatgagcttataagaaacatgagccagcttatg
gagatgggagaggccagcgacgatctcgcatcccagatgatatatcagctggtagctgag
ttggccaaggctcagccaacgcctgtgcagtggaggggcatccgtgaggaagttgcacct
gaggctcagctcagagggaagacagaaagagttcctaaaaaccccaccgtgaaaaactca
ggcaagctgacttttaagccaaaaggacctgttctcatgaggcaaattctacccccttcg
gtttcatttaacaaaacaataaatgcaaggattgggaatacagtgtacattacaaaaagc
acggagatcatcaatatactttgcagcctcattactcccagcaaggaggccacatacaca
tggaccaaggatggagcgctgctgcaaccctctgtcaagatcattttggatgaaactggg
aagatgcaaatacgaaatcctacaaggaaagagcaagggatatatgaatgttctgtagcc
agtcatctgggttccgatgtggaaagctcactagtgctatatgcagaggcacctgtcatc
ttgtctattgaaagaaatgtcaccaaaccagaacacaatcatctgtctgttgttgtggga
ggcactgtggaggcagcccttcaagcaaatgtgacaatccactgtcctgtaaaaggtgtc
cctcagcctaatgtaacttggttgaagacaggaggatctctgagtgacaatgtttccttg
cttttcaatggatccctgttgttgcagagtgcttcactcgaaaatgaaggaacctacatt
tgcacagccaccaatgctcttgggaaagcagtggcaacctctgggctccgcttgctggaa
cgaagagaaccaggcggtaaggctgcgttccctaaggtccagaaaacgcgagttctccag
gcacccagaagcagaataaacagcaacaacttaacaggaaagtccctgcctcaagagcac
ttttgggaacctggcaactggacacactgttctgccacttgtggtcccttggggttccgg
cttcagaggccccggtgtgtgatggccagtggtcaggaagtgagtgaagccctgtgtggt
ccccacaggaagccgctggctgggtttcagtcctgtaacatccgggattgcccagcaagg
tggtttacaagcatgtggtcagagtgctccgcgtcttgtggtgaaggatttcacagtcgg
caagtgacatgcaagcagacaaaagccaatgggactgtgcaggtggtgtccccaagggca
tgtgctcctaaagacaggcctctagggagaaaaccatgttccattcgtccatgtgttcaa
caggccatcgacccaggaaaccagtgtcctggacgttgcatgggccatgccacgaggatg
cagcaccaccacactgcttgttcccacaacagctccagctctgactgtgaggacggaagg
agacctgcctttggaaggaactgcaccttggggccatgtgaagcatgttggcgtgtgggc
ccctggaagccctgtacagcagtctgtggcaggggcttccagtctcgcaaagtcgactgc
attcacacagggagctgcaaaattgtggcggacagatactgtgtgcaggtgaaaccagct
gcctggaggcactgtctcgggccttcctgtgatagaaactgcacggacacaactcactac
tgtatgttcgtaaagcaccttaacctgtgctctctggccgtctacagacaaaggtgctgc
cagtcatgtcaagaagggtaa

DBGET integrated database retrieval system