KEGG   Mus musculus (mouse): 269966
Entry
269966            CDS       T01002                                 

Gene name
Nup98, 4732457F17, AI849286, Nup96
Definition
(RefSeq) nucleoporin 98
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05014  Amyotrophic lateral sclerosis
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    269966 (Nup98)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    269966 (Nup98)
  09172 Infectious disease: viral
   05164 Influenza A
    269966 (Nup98)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    269966 (Nup98)
   03036 Chromosome and associated proteins [BR:mmu03036]
    269966 (Nup98)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     269966 (Nup98)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    269966 (Nup98)
SSDB
Motif
Pfam: Nup96 Nucleoporin2 Nucleoporin_FG ANAPC3
Other DBs
NCBI-GeneID: 269966
NCBI-ProteinID: NP_001274093
MGI: 109404
Ensembl: ENSMUSG00000063550
Vega: OTTMUSG00000061195
UniProt: Q6PFD9 A0A1B0GSX7
Structure
PDB: 
3TKN

Position
7 E2; 7 54.71 cM
AA seq 1816 aa
MFNKSFGTPFGGSTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTSNSLFGTASTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGGGTTAGLFGSSPATSSATGL
FSSSTTNSAFSYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTPNTGF
SFGNTSTLGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQPNTGFGAV
GSTLFGNNKLTTFGTSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNNSGSSIF
GSKPAAGTLGTGLGTGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTSTAILGFG
APQAPVALTDPNASAAQQAVLQQHLNSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAA
QKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNHDSEDLASPSEYPENGERFSFLSKPVDENNQQDGEDDSLVSRFYT
NPIAKPIPQTPESVGNKNNSSSNVEDTIVALNMRAALRNGLEGSSEETSFHDESLQDDRE
EIENNAYHIHPAGIVLTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGD
VNLTNLNLDDIVHIRRKEVIVYVDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPPKTT
SKKLKTAPLPPAGQATTFQMTLNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVPD
SVLEESVPEDQEPVSASTHIASSLGINPHVLQIMKASLLVDEEDVDAMDQRFGHIPSKGE
TVQEICSPRLPISASHSSKSRSIVGGLLQSKFASGTFLSPSASVQECRTPRTSSRMNIPS
TSPWSVPLPLATVFTVPSPAPEVQLKTVGIRRQPGLVPLEKSITYGKGKLLMDMALFMGR
SFRVGWGPNWTLANSGEQLHGSHELENHQVADSMEYGFLPNPVAVKSLSESPFKVHLEKL
GLRQRKLDEDLQLYQTPLELKLKHSTVHVDELCPLIVPNPGVSVIHDYADWVKDSPGDFL
ELPIVKHWSLTWTLCEALWGHLKELDGQLDEPSEYIQTLERRRAFSRWLSHTAAPQIEEE
VSLTRRDSPVEAVFSYLTGSRISEACCLAQQSGDHRLALLLSQLVGSQSVRELLTMQLAD
WHQLQADSFIHDERLRIFALLAGKPVWQLSEQKQINVCSQLDWKRTLAIHLWYLLPPTAS
ISRALSMYEEAFQNTPEGDKYACSPLPSYLEGCGCMVEEEKDSRRPLQDVCFHLLKLYSD
RHYELNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSEQCEGVLQASYAGQLESEGL
WEWAIFVFLHIDNSGMREKAVRELLTRHCQLSETPESWAKEAFLTQKLCVPAEWIHEAKA
VRAHMESNKHLEALYLFKAGHWNRCHKLVIRHLASDAIINENYDYLKGFLEDLAPPERSS
LIQDWETSGLVYLDYIRVIEMLHRIQQVDCSGYELEHLHTKVTSLCNRIEQIPCYNAKDR
LAQSDMAKRVANLLRVVLSLQHAPDATSNSTPDPQRVPLRLLAPHIGRLPMPEDYALEEL
RGLTQSYLRELTVGSQ
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgtttaacaaatcatttggaaccccctttgggggtagtacagggggctttggcacaacg
tcaacatttgggcaaaatactggctttggtacgactagtggaggagcatttggaacatct
gcatttggttctagcaacaatactggaggcttatttggaaattcacagaccaaaccagga
ggattatttggtaccagttcatttagccagccagcaacctccacaagcactgggtttggg
tttggcacatcaacaggaacatcaaatagcttatttggaactgcaagtaccgggaccagt
cttttctcatcccagaacaatgcatttgcacaaaataaaccaactggctttgggaatttt
ggaaccagtactagcagtggaggactctttggaactacaaataccacctctaatcctttt
ggtagcacatctggctccctttttgggccaagtagttttacagcagcacctacaggaact
accatcaaatttaatcctcccactggtacagatactatggtcaaagctggagttagcact
aacatcagtacaaagcatcagtgtattactgctatgaaagaatatgaaagcaagtcatta
gaggaactacgtttggaggattatcaggctaaccggaaaggcccacagaaccaagtggga
ggaggcaccacggctggcttatttgggtcttctccagcaacttccagtgcaacagggctc
ttcagctcctccaccactaattcagccttttcatatggtcagaacaaaactgcctttgga
actagcacaactggatttggaacaaatccaggtggtctctttggccaacagaatcaacag
actaccagtctcttcagcaaaccatttggccaggctacaaccaccccgaatactggcttt
tcctttggtaataccagcacccttggacagccaagcaccaatactatgggcctatttgga
gtaacccaagcctcacaaccaggaggtctttttgggacagctacaaacaccagcactggg
acagcatttgggacaggaacaggtctctttgggcagcccaatactggatttggtgcagtt
ggttcgaccctgtttggcaataacaagcttacaacttttggaaccagcacaaccagtgct
ccttcatttggtacaaccagtggcgggctcttcggtaacaaaccaaccctgactttagga
accaatacaaacacttccaattttgggtttggcacaaataacagtgggagcagtattttt
ggaagtaagccagcagctggaactttgggaactggacttggtacaggatttggaacagct
cttggtgctggacaggcatctttgtttggaaacaaccaacctaagattggagggcctctt
ggtacaggagcctttggggcccctggatttaatacttcgacagccattttgggctttggc
gccccccaggccccagtagctttgacagatccaaatgcttctgctgcccagcaggctgtt
ctccagcagcacctcaatagcctaacatactcaccctttggagactcccccctcttccgg
aatcctatgtcagatcctaagaagaaagaagagagactgaaaccaaccaatccagctgct
cagaaagctcttacaacacctactcattataaacttacacctcgccctgctaccagagtc
aggccaaaggctttgcaaacaacaggcacagccaaatcacatctctttgatgggctggat
gacgatgaaccatctctagccaacggagcattcatgcctaaaaagagcatcaagaagttg
gttttgaaaaatctcaacaatagcaatctcttttctcctgttaatcatgattcagaagat
ctagcttcaccctctgagtatccagaaaatggagaaagatttagcttcctgagcaaacct
gttgatgagaacaatcagcaggatggagaagatgactctcttgtatcacgattttacact
aatcctattgccaaacccattccacaaactccagagagtgttggaaacaaaaataacagt
agcagcaatgtggaagataccattgttgccttgaacatgcgtgctgctttgcgcaatgga
ttggaaggaagcagtgaagagacgtcattccatgatgagtcattgcaagatgaccgagaa
gagatagaaaataatgcttaccacatacacccagcaggcattgttctcacaaaagttggt
tattacactatcccatctatggatgaccttgctaaaattaccaacgagaagggagaatgc
attgtttctgacttcaccattggtcgtaaaggatatggctcaatctattttgaaggagat
gtgaatttgacaaatctaaatttggatgatattgtgcatatccgaaggaaagaagttatt
gtctatgtagatgataaccaaaagccacctgtgggtgaagggctaaataggaaggctgaa
gttactttggatggagtttggccaacagataaaacatcccggtgtttaataaagagtcca
gatcgacttgctgatatcaactatgaggggagattagaagcagtctcaagaaagcaaggg
gcccaattcaaggagtatcggcctgaaactggttcttgggtatttaaggtctcccatttt
tccaagtatggccttcaggattctgatgaagaggaggaggaacacccacccaaaacgact
tcaaagaagctgaagactgcccctttgccccctgcaggccaggcaaccactttccagatg
actcttaatggcaagcctgcacccccacctcagagccagagcccagaagtggagcagtta
ggcagggttgtggaactggacagcgacatggtagatatcacccaggagccagttccagat
tctgtgttagaagagagtgtgcccgaggatcaggagcctgtgtctgcttcaacgcatatt
gcatcttcactgggaattaatccacatgttttacagatcatgaaagcatcattgcttgtt
gacgaagaagatgtagatgccatggatcaacgctttggtcacatcccttccaaaggagag
actgtccaggaaatctgttctcctagactccccatttcagcctcccactcatcaaaatcc
cgctccatagttggtgggttgctgcaatcaaaatttgcaagtggaacttttctttcacca
agtgcctccgtgcaagaatgtcgcactcccaggacatcatctcgcatgaacatcccatcc
acatccccctggtctgtccctctgcccctggccactgtgttcacagtgcccagcccagcc
cctgaggttcagctaaaaacagtggggatacgaaggcaaccaggcctagtccctcttgaa
aaatccattacatatggcaaggggaagctcttgatggacatggccctattcatgggacgt
tcatttcgggttggttggggtcccaactggactcttgctaatagtggagaacaactgcat
ggctcccatgaactggaaaatcatcaggttgccgattctatggaatatggattcctgccc
aatccagtagctgttaaatctctatctgaatccccattcaaagttcatttggaaaaactc
ggcttaagacagaggaagctggatgaagatctgcagttataccagacacctctagagctc
aaattaaaacatagcactgtccatgtagatgagctgtgtcctctcattgtccccaaccct
ggggtttcagtcattcatgattatgcagattgggttaaggactcacctggagatttcctg
gaactaccaattgtgaagcactggagcctgacatggacattatgtgaagccctatggggc
cacctgaaggagcttgacggccagctggatgagcccagcgaatacattcagactctggag
cgtagaagagctttttcccgctggctgtcacataccgctgcacctcagattgaagaggaa
gtctccttaacccgcagagacagtcccgtagaggctgtcttcagctacctcacgggcagt
aggattagtgaggcctgttgtctggcacagcagtcaggtgatcatcgccttgcccttctt
ctgtctcagttggtgggaagccagtcagtccgggagctgctcaccatgcagttggccgat
tggcatcagctccaggctgactccttcatccacgatgagcgattgcgcatatttgccctg
ttggctggaaaaccggtgtggcagctctcagagcagaaacaaatcaatgtttgctcccag
ctagattggaaacgaacacttgctatccatctttggtatttgcttccgccaaccgcctcc
atttccagggctctcagcatgtatgaagaagcatttcagaatactcctgagggtgataaa
tatgcctgctcccctcttccttcttacctggagggctgcggctgtatggtagaggaagaa
aaagactcccggagaccacttcaagatgtttgctttcatcttctaaaactctacagtgac
agacattatgagctcaatcagctattagaacctcgaagcataactgcagatcctttggac
taccgcctgagctggcacctttgggaagtgctacgtgctcttaactatacccatctctca
gaacagtgtgaaggtgtgctacaggccagttatgctggccaactggaaagtgaaggactc
tgggagtgggccatctttgtcttcctacacattgacaactcgggcatgcgtgagaaggct
gttcgagagctgctgacaaggcactgccaactgtcagagacccctgagtcttgggctaag
gaggcgttcctcacacagaagctttgtgtgcctgctgagtggattcatgaggccaaagca
gttcgagcacacatggaatccaataagcacttggaggccctctatttatttaaagctggt
cactggaaccgctgccacaaactagtcattcgtcacctagcttctgatgccattattaat
gagaactatgactacctgaaaggattcttagaagatctggcacctccagagcgcagcagc
ctcatccaggactgggaaacatctgggctcgtttacctggattatattcgagtgattgaa
atgctccaccgtattcagcaggtggattgctcaggttatgaactagagcacttacatacc
aaagtgacttcactgtgcaatcggatagaacagattccgtgttacaatgccaaggatcgc
ctggctcaatcagatatggccaagcgggtagccaacttactgcgggtagtgctgagcctt
cagcatgctcctgatgccacctccaactcaacgccagaccctcagcgagtccctttgcgt
cttttggctccccacattggcaggctccccatgcctgaggactacgccttggaggaactg
cgaggccttacccagtcctaccttcgagaactgactgttgggagccagtga

DBGET integrated database retrieval system