KEGG   Mus musculus (mouse): 269999Help
Entry
269999            CDS       T01002                                 

Gene name
Orai3, 9930124N15, BC061259, Tmem142c
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 3
  KO
K16058  calcium release-activated calcium channel protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    269999 (Orai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    269999 (Orai3)
Ion channels [BR:mmu04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   269999 (Orai3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Orai-1 KASH
Motif
Other DBs
NCBI-GeneID: 269999
NCBI-ProteinID: NP_940816
MGI: 3039586
Ensembl: ENSMUSG00000043964
Vega: OTTMUSG00000031096
UniProt: Q6P8G8 A3KCG3
Position
7; 7 F3
AA seq 290 aa AA seqDB search
MKGGEGDTGEQAPLNPEVDSPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAK
LKASSRTSALLSGFAMVAMVEVQLENDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLL
PHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAP
MGKPAPVVPMSQVPPVTVSLSLASNLTPSSASITTSQQPSKACPPRQVCDSAHGPGWQAA
MASTAIMVPVGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQAV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcggcgagggggacacgggcgaacaggccccgctgaacccggaggtggacagc
cccgcgggctcagccacgtaccgggagttcgtgcaccgcggctacctggaccttatgggg
gccagtcagcactctctgcgggcgctcagctggcgccgcctctacctcagccgggctaag
ctcaaagcctccagccgcacatctgctctgctgtcgggcttcgccatggtggccatggtg
gaggtacagctggagaacgatcatgaatacccaccaggcctgctggtggcatttagtgcc
tgcaccactgtgttagtagctgtgcacctctttgcactgatggtctccacatgtctgctg
ccccatattgaagccgtgagcaacatccacaatctcaactctgtccaccagtcaccacac
caacgactgcacagatacgtggagcttgcctggggcttctctactgccttgggtaccttt
ctcttcctggctgaagttgttctggtgggctgggtcaagtttgtgcccattggggcaccc
atgggtaaaccagctcctgttgtacctatgtcccaggtgccacctgtgactgtctccctt
agtttagcttctaacctcacaccatcctctgcttctattaccacatcacaacagccttcc
aaagcctgtccaccccggcaagtgtgtgatagtgctcatggaccaggctggcaggcagct
atggcctccacggcaatcatggtacctgtgggactagtgtttatggcctttgccctacat
ttctaccgatccttggttgcccacaagacagaccgccacaagcaggagctggaggagctc
agtcgcctgcagggggagctgcaggctgtgtaa

DBGET integrated database retrieval system