KEGG   Mus musculus (mouse): 270035Help
Entry
270035            CDS       T01002                                 

Gene name
Letm2, 6030453H13, D030041N04Rik
Definition
(RefSeq) leucine zipper-EF-hand containing transmembrane protein 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LETM1 SAP V_ATPase_I BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 270035
NCBI-ProteinID: NP_766600
MGI: 2444979
Ensembl: ENSMUSG00000037363
Vega: OTTMUSG00000060558
UniProt: Q7TNU7
Position
8; 8 A2
AA seq 480 aa AA seqDB search
MAFYSYNSFLAIFWTRLPGHSVYPSCSHFPSLAFLHLPDSHLRTAYIKNCGSRKYSYPSL
TGNNKVHPLRTRLPQKLHTTCWLQHVPGKPQLEQTGKPKAASPQPTKEAKTETTEEKRSL
RQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFM
VFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMAR
RNRAKLGDASSQLSSYVKQVQTGHKPSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLE
LQTFGTNNLLRFQLLMTLKSIKADDEIIAKEGVKALSVSELQSACRARGMRSLGLTEEQL
CQQLTGWLDLHLKENVPPSLLLLSRTFYLIDVKPKPIELPPNIETPKPNLGIPTPPPPES
KENLTDSAPQLKGTKDEEFIQLPPVPSSLIAPAATISKEAILQAKSQETSQNSKADSKGA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggccttctacagttataattcattcttagctattttctggacaagactgcctggccat
tctgtgtacccttcctgctctcatttcccatcacttgcatttctccacttgccagattct
cacttgcgtacagcctacattaaaaactgcggaagcaggaagtactcctatcccagtcta
acaggcaataataaagtccatcccttacggaccaggctcccacaaaaactgcacacaacc
tgctggctacaacatgtccctggcaaacctcagctggagcaaacagggaagccaaaggca
gcaagccctcagcctaccaaagaagccaagacagagactacagaagaaaagcggtcgttg
agacaaaaaattgtgaatgaacttaaatactattacaaaggattcagcttgctttggatt
gacaccaaagtcgctgccagaatagtgtggaggctactgcatggtaatgcgctaaccaga
cgagagaggcgaaggctgttgagaacgtgtgccgatgtcttccgcttggttccatttatg
gtgttcataattgtaccttttatggagttcttgataccagtgtttctgaagctcttccca
gacatgttgccatcaacttttgaaagtgaatccaaaaaggaagaaaaacagaaaaaaacg
atggctgccaaactggaaatagcaaaattccttcaagaaacaatgacagagatggcgagg
agaaaccgagcgaagctgggagatgcatcttcccagctttcctcctatgtgaaacaggtc
caaacaggtcacaagccctccacgaaggagatagttaggttctccaaactcttcaaggat
cagttagccctggaacacttagaccggccccagctggttgccctgtgcaagctgctggaa
ctgcagaccttcggaacaaacaatctgctccgcttccagctcctgatgacactgaagtct
ataaaagcagatgatgaaataattgccaaagaaggggtgaaggctttgagtgtgtcagaa
ctgcagtctgcgtgccgggcccgggggatgaggtcgctgggcctcactgaggagcaactg
tgccagcagctcacagggtggctggacctccacttgaaggagaacgtccctccttctctt
ttgctcctgtcgcgcaccttctacctgatagatgtgaagccaaagcctattgaacttcca
ccgaatatagagactccaaagccaaaccttggaataccgacacctccaccccccgagtca
aaggagaacctcacagactctgcacctcagctgaagggaacgaaggatgaagaatttata
caactgcccccagtaccgtcatcactcatagcaccagcagcaactatttccaaagaagca
atcctccaggccaagtcccaggagacctcacagaacagcaaggctgattccaaaggagcc
taa

DBGET integrated database retrieval system