KEGG   Mus musculus (mouse): 27007Help
Entry
27007             CDS       T01002                                 

Gene name
Klrk1, D6H12S2489E, NKG2-D, Nkg2d
Definition
(RefSeq) killer cell lectin-like receptor subfamily K, member 1
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    27007 (Klrk1)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    27007 (Klrk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    27007 (Klrk1)
   04091 Lectins [BR:mmu04091]
    27007 (Klrk1)
CD molecules [BR:mmu04090]
 Proteins
  27007 (Klrk1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   27007 (Klrk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Chordopox_A33R UL45
Motif
Other DBs
NCBI-GeneID: 27007
NCBI-ProteinID: NP_149069
MGI: 1196250
Ensembl: ENSMUSG00000030149
Vega: OTTMUSG00000032505
UniProt: O54709 Q4FJM0
Structure
PDB: 

Position
6 F3; 6 63.44 cM
AA seq 232 aa AA seqDB search
MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKL
KISPMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWI
CHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANG
SWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattcgtgatcgaaagtctcatcactcagagatgagcaaatgccataattac
gacctcaagccagcaaagtgggatacttctcaagaacaacagaaacaaagattagcacta
actaccagtcaacctggagaaaatggtatcataagaggaagataccctatagaaaaactc
aaaatatctccaatgttcgttgttcgagtccttgctatagccttggcaattcgattcacc
cttaacacattgatgtggcttgccattttcaaagagacgtttcagccagtattgtgcaac
aaggaagtcccagtttcctcaagagagggctactgtggcccatgccctaacaactggata
tgtcacagaaacaactgttaccaattttttaatgaagagaaaacctggaaccagagccaa
gcttcctgtttgtctcaaaattccagccttctgaagatatacagtaaagaagaacaggat
ttcttaaagctggttaagtcctatcactggatgggactggtccagatcccagcaaatggc
tcctggcagtgggaagatggctcctctctctcatacaatcagttaactctggtggaaata
ccaaaaggatcctgtgctgtctatggctcaagctttaaggcttacacagaagactgtgca
aatctaaacacgtacatctgcatgaaaagggcggtgtaa

DBGET integrated database retrieval system