KEGG   Mus musculus (mouse): 270097
Entry
270097            CDS       T01002                                 

Symbol
Vat1l, 9430073I07, AI427515, mKIAA1576
Name
(RefSeq) vesicle amine transport protein 1 like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_N ADH_zinc_N
Other DBs
NCBI-GeneID: 270097
NCBI-ProteinID: NP_766604
MGI: 2142534
Ensembl: ENSMUSG00000046844
Vega: OTTMUSG00000031710
UniProt: Q80TB8
Position
8; 8 E1
AA seq 417 aa
MAKEGVEKAEETEQMIEKETSKEPAEGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLSRKA
MPEPQDGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEI
GDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYTMLFEIANLREGM
SVLVHSAGGGVGQAVAQLCSTVPNVTVFGTASTFKHEAIKDSVTHLFDRNADYVQEVKRI
SAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEKVN
PIKLYEENKVIAGFSLLNLLFKQGRSGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEVKE
AMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQ
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctaaggaaggcgtagagaaagcggaggagaccgaacaaatgattgagaaggagacc
agcaaggaacctgctgagggcggcgacggctcccaccgcctcggggatgcccaggagatg
cgcgctgtggtgctggccggcttcggcggactcaacaagctgaggctctctagaaaggcc
atgccggagccacaggacggcgagctcaagatccgcgtcaaagcctgtggcttaaacttc
attgacctgatggtgcgacagggcaacattgacaaccctcccaagacccccttggtgcca
ggattcgaatgttctgggattgttgaagctctgggggacagcgtaaaaggatacgagatt
ggagatcgtgtcatggcatttgtcaactacaatgcctgggctgaagtggtgtgtactcca
gtggagtttgtctacaagatcccagatgacatgagtttctctgaggctgctgctttcccc
atgaatttcgtcaccgcatacacgatgctctttgaaattgccaacctccgcgaaggcatg
tccgtgctcgtgcactcagccggcggtggagtgggtcaagctgtggctcagctgtgctct
accgtccccaatgtgaccgtctttggaacagcctctactttcaagcatgaagccatcaaa
gattcggtgacccacctctttgacagaaatgcagactacgtgcaggaagtaaagaggatc
tcagctgaaggcgtggacatcgttttggattgcctgtgtggggacaacactggcaagggg
ctcagtctcctcaaacctctggggacctacattttatatggttcatccaacatggtaact
ggagagaccaagagtttctttagttttgcaaagtcatggtggcaggtggagaaagtgaac
cccatcaagctgtatgaagaaaacaaagtcatcgccggattctcactcctcaatctgctc
ttcaagcagggccgctcaggcctcatccgaggggtggtagagaagctcatcgggctgtac
aaccagaagaagatcaagccagtggtggattccttatgggccctggaggaggtaaaagag
gccatgcagcgcatccacgaccgagggaacatcgggaagttaattctggatgtggaaaag
acgccgaccccgctgatggccaatgacagcacagagaccagcgaggcaggggaggaagaa
gaggaccatgaaggggacagcgagaacaaagagaggatgcccttcatccagtaa

DBGET integrated database retrieval system