KEGG   Mus musculus (house mouse): 270120
Entry
270120            CDS       T01002                                 
Symbol
Fat3, 9430076A06Rik, D430038H04Rik, Gm1132, Gm510, MFAT3F
Name
(RefSeq) FAT atypical cadherin 3
  KO
K16506  protocadherin Fat 1/2/3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    270120 (Fat3)
   04515 Cell adhesion molecules [BR:mmu04515]
    270120 (Fat3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   270120 (Fat3)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Cadherin related
   270120 (Fat3)
SSDB
Motif
Pfam: Cadherin Laminin_G_2 Cadherin_3 Laminin_G_1 RET_CLD1 EGF hEGF EGF_CA Cadherin_4 Big_9 DUF777
Other DBs
NCBI-GeneID: 270120
NCBI-ProteinID: NP_001074283
MGI: 2444314
Ensembl: ENSMUSG00000074505
UniProt: E9QK16
Position
9:complement(15821485..16413981)
AA seq 4555 aa
MSVTMGHCMGTKPPSCIILLLLKLFATVSQGLPGTGPLGFHFTHSTYNATVYENSAARTY
VNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREI
QDNYLLIIKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVT
ATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLY
GNNGVSSTAKLYVHIERINEHAPIIHVVSHTPFSLDKEPTYAVVTVDDLDEGANGEIESL
SIVDGDPLEQFFLAKEGKWLNEYKVKERRQVDWESFSYGYNLTIQAKDKGSPQKFSELKT
VHIANPRRDNTPVRFEKDVYEVSISEFSPPGVLVAIVKVSPEPLDVEYKLLPGKDSDYFK
INPRSGLIVTAQPLNTVKKEVYKLEVSDKEGDAKAQVTIGIEDANDHTPEFQEALYETFV
NESVRVGTNVLTVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSPE
TYRFIVRASDWGSPYRHESEVNVTIRVGNVNDNSPLFEKVACQGVISYDFPVGGHITAIS
AIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLMNSGIKNGNFALRITATDGENF
ADPMAINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQ
GPHFDKSFPSDVAVKEDMLVGTNILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETG
QLKVLMPMDREHTDLYVLNITIYDLGKPQKSSWRLLTVNVEDANDNNPVFLQDSYSVSIL
ESSSIGTEIIQVEARDKDLGSNGEVMYSVLTDTHQFIINSSTGIVYIADQLDRESKANYS
LKIEARDKAESGQQLFSVVTLKIFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETQ
DPDLGLGGQVRYSLVNDYNGRFEVDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSL
SSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTAHDEDSGRDGEIQYS
IRDGSGLGRFNIDDESGVITAADSLDRETTASYWLTVYATDRGVVPLYSTIEVYIEVEDV
NDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSGSNEKLTYRITSGNPQNFFAINIK
TGLITTTSRKLDREQQAEHFLEVTVTDGGSSPKQSTIWVVVQVLDENDNRPQFPEKVYQI
KLPERDRKKRGEPIYRAFAFDKDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA
GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDKVTEIV
GVVSVQPANTPLWFDIVGGNFDSSFDAEKGVGTIVIAKPLDAEQRSVYNMSVEVTDGTNI
AVTQVFIKVLDNNDNGPEFSQPHYDVTISEDVLPDTEILQIEATDRDEKHKLSYTIHSSI
DAVSMRKFRMDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDAND
HSPYFTNPLYEASVFESAALGSVVLQVTALDKDKGENAELIYSIEAGNTGNTFKIEPVLG
IITISKEPDMAAMGQFVLSVKVTDQGSPPMSATAIVRISISMSDNSHPKFTHKDYQAEVN
ENVDIGTSVILISAISQSTLIYEVKDGNINGVFTINPYSGVITTRRALDYEHTSSYQLII
QATNMAGMASNATISVQIVDENDNPPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRAT
DADSNQNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHEAIAHFHFHVHVRDSGNPQL
TAESPVEVNIEVTDVNDNPPVFTQAVFETVLLLPTYIGVEVLKVSATDPDSEVPPELTYS
LMEGSVDNFLMDPNTGVLTIKNNNLSKDHYMLIVRVSDGKFYSTAMVTVMVKEAMDSGLH
FTQSFYSTSISENSTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVP
FDREEQELYELVVEASRELDHLRVARVVVRVNIEDVNDNSPVFVGLPYYAAVQVDAEPGT
LIYRVTAIDKDKGANGEVTYVLQDDYGHFEINPNSGNVILREAFNSDLSNIDYGVTILAK
DGGNPSLSTFVELPITIVNKAMPVFDKPFYTASINEDITMNTPILSINATSPEGQGIIYL
IIDGDPFQQFNIDFDTGVLKVISPLDYEVTSVYKLTVRASDALTGARAEVTVDLLVDDIN
DNPPVFDQPTYNTTLSESSLIGTPVLQLVSTDADSGNNKLVRYQIVQDTYNSTDYFHIDS
SSGLILTARMLDHELVQHCTLKVTATDNGFPSLSSEVLVQIYISDVNDNPPVFNQLIYES
YVSELAPRGHFVTCVQASDADSSDLDRLEYSILSGNDRASFLMDSKSGVLTLSSHRKQRM
EPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENAASGTKVIHVRAT
DGDPGTYGQVSYSIINDFAKDRFLIDSNGQIITTERLDRENPLEGDISIYLRALDGGGRT
TFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQALDPDDGANSRITYSLYS
EASVSVADLLEIDPDNGWMVTKGNFNQLRNTVLSFFVKAVDGGIPVRHSLIPVYIHVLPP
ETFLPSFTQSQYSFTITEDTSIGSTVDTLRILPNQSVRFSMVNGERPENNKEGVFIIEQE
TGAIKLDKRLDHEVSPAFHFKVAATIPLDKVDIVFTVDVDVKVLDLNDNKPVFETSTYET
IIMEGMPVGTKLAQVRAIDMDWGANGQVTYSLHSDSHLEKVIEAFNIDSNTGWISTLKDL
DHETDPAFSFFVVASDLGEAFSLSSMALVSVKVTDINDNAPVFAHEVYRGNVKESDPPGE
VVAVLSTLDKDTSNINRQVSYHITGGNPRGQFALGMVQSEWKVYVKRPLDREEQDIYFLN
ITASDGLFVTQAMVEVTVSDVNDNSPVCDQVAYSASLPEDIPSNKIILKVSAKDADIGSN
GDIRYSLYGSGNNEFFLDPESGELKTLAVLDRERVPVYNLIARATDGGGRFCSSSVLLLL
EDVNDNPPVFSSNHYTACVYENTATKALLTRVQAMDPDVGINRKVVYSLEDSASGVFSID
SSSGVIVLEQPLDREQQSSYNISVRATDQSPGQSLSSLASVTITVLDINDNPPVFERRDY
LVTVPEDTSLGTQVLSVFATSKDIGTNAEITYLIRSGNEQGKFSINPKTGGISVLEALDY
ETCRRFYLVVEAKDGGTPALSTAATVSIDLTDVNDNPPRFSQDVYSAVISEDALEGDSVI
LLIAEDVDSKPNGQIRFSIVGGDRDNEFAVDPILGLVKVKKKLDRERVSGYSLLIQAVDS
GIPAMSSTTTVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPP
FSFSILSGNEDEEFMLDSHGILRSAVVFRHMESPEYLLCIQAKDSGKPQQVSHTYIRVRV
IEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSH
DGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFEDVSPEDF
VGLHMHGFRRILRNAVLTQKQDSLRIISIQPVVGTNQLDMLFAVEMHSSEFYKPAYLIQK
LSNARRHLENVMHIAAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYR
NVRCTCNGGVCPGSNDPCVEKPCPEDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFA
GNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCMILKIVEGKLWFQLDCGSG
PGILGISSRAVNDGSWHSVFLELNRNFTSLALDDSYVERRRAPLYFQTLSTDSAIFFGAL
VQADNVRSLTDTRVTQVLGGFQGCLDSVVLNHYELPLQNKRSSFAEVVGLTELKLGCVLY
PDACQRSPCLHGGSCSSLPSGGYQCSCLSQFTGTNCESEITACFPNPCRNGGSCDPIGNT
FVCSCKAGLTGVTCEDDVDECEREECENGGSCVNLFGSFFCNCTPGYVGQYCGLRPVVVP
NIQAGHSYVGKEELIGIAVVLFVIFTLIVLFIVFRKKVFRKNYSRNNITLVQDPATAALL
HKSNGIPFRSLRAGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKGLDVLGGEPQE
MSTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDTGSENKGTEDTGEV
TCFTNSNKGSNSEVQSLSSFQSDSGDDNAYHWDTSDWMPGARLSDIEEMPNYESQDGGAA
HQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSRDQLPPPLPEDFPDQYEALPPSQPTSL
TSTMSPDCRRRPRFHPSQYLPPHPLPGETDLGGPSSSCDFSTFAVNMNQGTEVMAPTDSV
SLSLHNSRGTSSSEMSARCGFDDSEVAMSDYESAGELSLTNLHIPFVETQQQTQV
NT seq 13668 nt   +upstreamnt  +downstreamnt
atgagtgtgactatgggacactgtatgggcacaaagcctccttcttgcatcattctcctg
ctcctgaagctgtttgccactgtctcccaggggttgccagggacagggcccctgggcttc
cactttacacactccacctataatgctacagtgtatgagaactcagcagcgcggacctat
gtcaacagccagagcagaatgggcatcaccttaatagacctgtcctgggatatcaagtac
agaatagtgtctggtgatgaggaaggatttttcaaagctgaggaggtcatcattgcagat
ttctgctttctcaggataagaactaaaggtggcaattctgccatattgaacagggaaatc
caagacaattatttattaattataaaaggttcagtcagaggagaagacttggaagcatgg
accaaagtgaacatccaggttttagacatgaatgacttgaggcctctgttttcacccacc
acctactccgtcaccatcgcagaaagcacaccactcaggactagcgttgcccaggtgaca
gctacagatgcagacatcggttccaatggagaattctactactacttcaaaaacaaggtt
gatcttttttcagttcaccccacaagtggtgtcatctctttaagtggacgattaaattat
gatgaaaagaacagatacgatctagaaatcttagccgtggaccgggggatgaaactctat
ggcaataatggagtgagcagcactgccaaactttatgttcacattgaacgcataaatgaa
catgctcccattatccatgtggtcagtcacacccccttctcactggacaaggagccaaca
tatgcagtagtgacagtggatgacctggatgagggggccaatggagagatcgaatctctt
tccattgtggatggcgatcctttagagcagttcttcctggctaaagaaggaaagtggttg
aatgagtataaagtcaaggagagaaggcaggtggactgggaaagcttctcttatggctat
aacctcaccattcaagcaaaagacaaagggtcacctcagaagttttcagaattaaagaca
gttcacattgccaaccccaggagagacaacaccccagtcaggtttgaaaaggatgtctat
gaagtcagtataagtgagttttccccgcctggtgtcctggtggccatagtcaaggtaagt
cctgagccactggatgtagaatacaaactattgcctggtaaggattcagattacttcaaa
attaatccccggtcaggtctgattgtcacagcacagcccttgaatacagtgaagaaggaa
gtttataagctggaagtgtcagacaaggaaggagatgcaaaggcacaagtcaccattggg
attgaagacgccaatgaccacaccccagaattccaggaggcactgtatgagacgtttgtg
aatgagagtgttcgtgttggtacaaatgttctgaccgtgtctgcctctgataaagacaaa
ggggaaaatggctacatcacctacagcatcgccagcctgaaccttttaccatttgccatt
aatcagttcacaggtgtgatcagcacaactgaagagttagactttgaatcctccccagag
acatatagattcattgttagagcctctgattgggggtccccataccgccatgaaagtgag
gtgaacgtgaccattcgggtaggaaatgtcaatgacaacagccctctctttgaaaaagtg
gcttgccagggagttatttcatatgactttcctgttgggggtcacatcacagccatctct
gctattgatattgatgaacttgaacttgtaaagtacaaaatcatttctggaaatgaactt
gggtttttttatttaaacccagactctggtgttttgcagcttaagaagtcactgatgaat
tctggcattaaaaatggcaattttgccctcagaatcacagcaactgatggggaaaacttc
gcagaccccatggccattaacatctcagtcctccatgggaaagtatcttcaaagagcttc
agttgcagagaaactcgtgtggctcagaaattggcagagaaactactcattaaagcaaaa
gctaatgggaaactgaatctagaagatggatttcttgacttttattcaattaataggcaa
ggaccacattttgacaagtcttttccctctgatgtggctgtaaaggaggacatgctggtt
ggaactaacatcctgaagattaaagcatatgatgctgactctggcttcaacgggaaggta
ctatttacaatatcggatggaaatacagacagctgcttcaacattgatatggagactgga
caacttaaagtcctcatgcccatggatcgagagcatacagacctttatgtcctcaacata
accatctatgaccttggaaagccacagaagtcatcatggcgattgctgactgtcaatgtg
gaggatgctaatgacaataacccagtttttcttcaggacagctactcagtcagcattctt
gaaagttcaagtattggcacggagattattcaagtggaagcaagagacaaagacttgggt
tctaatggtgaggtaatgtattcagtcttgaccgacacacaccagtttatcatcaatagc
tcaactgggattgtttatatagctgatcagttggacagagaatccaaagccaactattct
ttgaaaatagaagccagggacaaagcagaaagtggccagcagctgttttctgttgtcact
ctgaagatctttctggatgatgtcaatgactgctctccagcttttattcccagtagctac
agcgtgaaggtccttgaagatcttcctgttggtacagtcattgcttggcttgaaactcag
gatcctgaccttggattggggggtcaagtacgttactctttggtcaatgactataatggg
agatttgaagtagacaaagcaagtggtgccatccgcttgagcaaagagttagactatgag
aagcagcaattctacaacctgacagtcagggccaaagacaaagggcggcctgtctctctg
tcatcagtttcctttgttgaggtggaggtggtagatgtcaatgaaaaccttcatacaccc
tatttcccagactttgctgttgttggatctgtaaaagaaaactcacggattggaacaagc
gtgctgcaggtgactgcccatgatgaggattctggtagggatggagagatccagtactct
atcagagatggcagtggtcttgggaggttcaacatagatgatgagagtggagtcatcact
gctgctgacagtcttgatcgagagacaacagcatcatactggctgacagtgtatgccaca
gaccggggcgtggtccctctctattccaccattgaggtttacatagaagtagaagatgtg
aatgacaatgccccactgacctcagagcccatctattatccagttgtcatggaaaattct
ccaaaggatgtgtctgtcattcagatacaagctgaggaccctgactctggttccaatgaa
aaactgacctataggattacaagtggaaacccacagaacttttttgccatcaatatcaaa
acaggtctgattaccacgacttcaaggaaattggaccgagagcagcaggcggaacatttt
ctggaggtgacagtgacggatggcggttcttctccaaaacagtcaaccatttgggtggtg
gttcaggttctggatgaaaacgacaacaggccccagttccctgagaaggtttaccagatc
aaacttccagaacgtgaccgcaagaagaggggcgaacccatttacagggcttttgccttt
gacaaagatgaaggccccaatgcagaaatctcctacagtattgtggatggaaatgatgat
ggaaagttttttattgaccctaaaactggcatggtctcttccagaaagcaattcacagca
gggagttatgacatcctgacgatcaaggctgtggacaatggccgcccacagaaatcctcc
actgcccgcctccacatcgaatggattaagaagcccccgccttcacctataccattgaca
ttcgatgaaccattttacaacttcaccgtcatggagagtgacaaagtaaccgagattgta
ggggtggtgtcagtgcagccagctaacacccctctatggtttgacatcgtcggggggaat
tttgacagctcttttgatgcagagaagggtgttggaacaattgtcattgcaaagcctttg
gatgcagagcaaaggtcggtgtacaacatgagtgtcgaggtcaccgatggaacaaatatt
gctgtcactcaggtatttatcaaagtgctagataataatgataatggcccagaattctcc
cagccacattatgatgtgacaatttctgaggacgtgcttcctgatacagagatactgcag
attgaggccacagacagagacgagaaacacaagctgagctacaccatccacagtagcatc
gatgccgtaagcatgaggaagttccggatggaccccagtacaggcgtgctctacacggct
gagagactggaccacgaagcccaggacaagcacatcctcaacataatggtcagagatcag
gaatttccttaccgaagaaacttggcccgagtcattgtgaacgtggaggacgctaatgat
catagcccctactttaccaatccactgtatgaagcatcagtgttcgaatcagctgctctg
ggatcagttgttctgcaagtgacagctctggacaaagacaagggggaaaatgcagaactc
atatattccattgaagcagggaacacggggaatacatttaagatcgaaccagtcctgggc
atcattaccatttccaaagagccagacatggcagctatgggtcagtttgtcctgtcagtt
aaagtcacagaccaaggctcaccaccaatgtctgccactgcaattgtacgcatctccatc
agcatgtctgataactcccaccccaagttcactcacaaagactaccaagctgaagtaaat
gaaaatgtggatattggaacatctgtcatcctgatttcagccatcagccagtcaaccctc
atctatgaagtcaaagatggaaacatcaatggagtctttaccataaatccatattctgga
gtcatcaccactaggagagctctggattatgaacatacctcttcctatcaactcatcatt
caggccactaacatggcaggcatggcttccaatgccaccatcagtgtgcagattgtagat
gaaaacgataacccccctgtgtttctcttttctcaatattcaggcagcctgagtgaggct
gcccccatcaacagcattgtcaggagcctagacaacagcccactcgtgatccgagccaca
gatgctgacagtaaccaaaatgcacttctggtgtatcagattgtggagtccactgccaag
aagttcttcacagtggactccagcacaggagccatcagaacaattgccaacctagaccat
gaagctatcgcacacttccacttccatgtacacgtgagagacagcgggaacccacagcta
accgcagagagtccagttgaagtcaacattgaggtgacagatgtcaatgataatccaccc
gtgttcactcaggctgtgtttgaaactgtcttacttctccccacctacattggtgtggag
gttctgaaggtgagcgccacagatcctgactctgaagtaccccctgaactgacatatagt
ctcatggaagggagtgtggataattttctaatggacccaaatactggagtgctcaccata
aaaaataataatctttccaaagaccactacatgctgatagtcagagtatctgatgggaag
ttctacagtactgccatggtcaccgtcatggttaaagaagccatggacagtggcctccac
ttcacacaaagcttctattccacctccatctcagagaacagcacaaacataaccaaagtt
gctattgtcaatgcagttggaaaccgccttaacgagccattaaaatacagcatcttaaac
ccaggaaataaattcaagataaaatctacctcaggagtcattcagaccacaggagtaccc
tttgaccgtgaagaacaggagttatatgagttggtggtggaagccagtcgtgagctagac
catttgcgtgtggccagggtggtagtcagggttaacattgaagatgttaatgataactct
cctgtctttgtgggtcttccttactatgctgctgtgcaagttgatgctgagccaggaact
ctgatataccgggtaacagccatcgacaaagataaaggtgccaatggagaagtgacctat
gtcttgcaggatgactatggtcactttgaaattaaccctaattcagggaatgttatttta
agagaagcattcaactcagatctctccaacattgactatggagtcaccattcttgccaag
gatggtggaaatccatctctgtccacatttgtggaacttcccatcaccattgttaacaaa
gcaatgcctgtgtttgataaacctttttatacagcatcaatcaatgaagatatcacaatg
aacactcccattctcagcatcaatgccaccagcccagaaggccagggcatcatatacctc
atcatcgatggagatcccttccaacaattcaacattgactttgacactggggtcctaaaa
gtcattagtcctttggattatgaagtcacatcagtttacaagttgacagtaagagctagt
gatgctcttacaggtgccagagctgaagtcactgtggacctgctagtggatgacatcaat
gataaccctcctgtctttgatcagcccacttacaacacaacactatctgaatcatctctt
attggaacacctgttctgcaacttgtctcaactgatgcggactcaggaaacaacaagctg
gtgcgttatcagattgtccaggatacttacaatagcacagattactttcacatagatagc
tcaagcggcttaatcctgacagccaggatgctagaccatgagttggtgcaacactgtacc
ctgaaagtcacagcaactgataatggttttccatccctgagcagtgaagtcctggttcag
atctatatttctgatgttaacgacaaccccccggtttttaatcagctcatttatgaatct
tatgttagtgaactagctccccggggtcattttgtaacctgtgtgcaagcctcagatgca
gacagctctgaccttgaccggttggaatacagcattttatcggggaatgatcgagccagc
tttctgatggacagcaagagtggagttctcacactgtctagccaccggaagcagcggatg
gagcctctgtacagtctcaacgtgtctgtgtctgatggactatttactagcactgcccag
gttcacatcagggtccttggggctaatttgtacagccctgccttttcacaaagcacatac
gtagctgaggtaagagagaacgcagcctctgggacaaaggttattcacgtccgagccacg
gatggagatccaggaacatatggacaggtcagctattccatcatcaatgactttgccaag
gatcggttcctcatagacagcaatggacagatcatcacaacagaaagactggaccgtgaa
aaccctctggaaggagatattagtatttatctgagggccttggatggcggtgggagaact
acgttctgcactgttcgggtgattgtggtggatgagaatgacaatgcccctcagttcatg
acagtggaatacagggccagcgtcagggctgacgtaggaaggggccacttggtcactcaa
gttcaagctttggatccagatgatggagcaaattctaggattacgtattccctctatagc
gaggcctcagtgtcagtggctgacctcttggaaattgatcctgataatggctggatggtg
accaaaggcaattttaaccaactaagaaacacggtgctgtccttctttgtgaaggcagta
gatggtggcattccagtcagacattccctcattcccgtctacatccacgtcctgcctcct
gagacatttctgccttccttcacccagtcacagtactcctttaccattacagaagataca
tccattggaagcacagtagacaccttaaggattctgcccaatcaaagtgtccggttcagc
atggttaatggagaaaggccagagaataacaaagagggtgtcttcatcatagaacaagag
acaggtgctatcaagcttgacaagcgccttgatcatgaagtcagcccagctttccacttt
aaagtagcagctactatacccttggacaaggtggacattgtattcactgtggatgtagat
gtcaaggtattggatctgaatgacaacaagccagtctttgaaacctcaacctacgagaca
atcataatggaggggatgcctgttggcaccaagcttgcccaggtgagagccatagacatg
gattggggagccaatgggcaggtgacttactccctacactcagattcccatcttgaaaag
gtaatagaagcattcaatattgacagcaacacaggatggatcagtacactgaaggacctg
gaccatgagacagaccctgccttctccttctttgtggtggcttctgacctcggagaggct
ttctccctttcttccatggctcttgtctcagtcaaggtgacagatataaatgacaatgca
ccagtctttgctcatgaggtgtaccgaggaaatgtgaaggagagcgacccaccaggggag
gtggtagctgttctcagcaccttggacaaagacacctccaacataaatcgccaagtgagc
taccacattacaggagggaacccccgaggacagtttgccctgggcatggtacagagtgag
tggaaggtctatgtgaagaggcctctggatcgagaggaacaagacatttacttcctcaat
atcactgcctctgatggactctttgtcacacaggccatggtagaagtgactgtcagtgat
gtaaatgacaacagcccagtgtgtgatcaggttgcatattcagcatcacttcctgaagac
attccatcaaataaaatcatcctgaaggtcagtgccaaggatgcggatattggatccaat
ggagatatacgatactcactctatggatctggaaacaatgaattttttctagatccagaa
agtggtgagttaaaaaccttggccgtgttggaccgagagagggtcccggtatacaacctg
attgccagggccactgatggaggcggccgcttctgcagctccagtgtcctcctgctcctg
gaagatgtgaatgataacccccctgtgttttcttccaaccactacactgcatgtgtctat
gagaacacggccaccaaggctctgctgaccagagtgcaagccatggaccctgatgttggc
atcaacaggaaggtcgtgtactccctggaggactcggccagtggagtcttctccatcgac
agctcctctggtgtcatagttctggaacagcctctagatcgagagcagcaatcatcctat
aacatcagtgtgcgggctacagaccagagtcccggacagtccctctcctctctcgcctct
gtcaccatcactgtcctggacattaatgacaaccctcctgtgtttgaaaggagagactac
ctggtaacagtgcctgaggacacttcccttggcacccaagtcctgtctgtttttgccacc
agcaaagatattggtacaaatgctgagataacttacctcatccggtctggaaacgaacaa
gggaaatttagcattaacccaaagacagggggtatttctgtcttggaagctctggactat
gaaacgtgcagaagattttacctggtggtggaagctaaagatgggggcaccccagccctc
agcactgcagccacagtcagcattgacctcacagatgtaaatgataaccctcctcggttc
agccaagatgtctatagtgctgtcatcagtgaagatgccttagagggggactctgtcatt
ctgctgatagcagaagatgtggacagcaagcctaatggacagattcgtttttccattgtg
ggtggagatagggacaatgaatttgctgttgatcccatcttgggacttgtgaaagttaag
aagaaactggaccgggagcgggtgtcaggatattccctgctcatccaggcagtagatagt
ggcattcctgcaatgtcctcaacgacaactgtcaacattgatatttctgatgtgaatgac
aacagtccagtgtttacacctgccaactacactgctgtgattcaggaaaataagccagtg
ggtaccagcatcttacagcttgtggtgacagacagagactcgtttcacaatgggcctccc
ttttccttctctattttgtcgggaaatgaagacgaggagttcatgctggactcccatggg
atcctacggtctgcagtggtcttccggcacatggagtctccagaatacctactgtgcatc
caggcaaaagactcaggaaaaccacagcaagtttctcacacctacatccgtgtccgggtc
attgaggaaagcactcacaaacccacagccatccctctggaaattttcattgtcaccatg
gaggatgattttcctggtggtgtcattggaaagatccatgccacggatcaggacatgtat
gacgtgctcacgttcgccctgaaatcagagcagaagagcttgttcaaagtgaacagtcac
gatgggaaaatcattgctctgggagggctggacagcgggaagtatgtcctgaacgtgtct
gtgagtgatggccgcttccaagtgcccatagatgtcgttgtgcacgtggagcagctggtg
catgagatgctgcaaaacactgtcaccatccgctttgaagatgtgtccccagaggacttt
gtggggctgcacatgcatgggttccggcgcattctgaggaatgccgtcctcacccagaag
caggacagtctgcgtatcatcagtatccagcctgtggtgggcaccaaccagctggacatg
ctgtttgctgtggagatgcacagcagcgagttctacaagccagcctatctgatccagaag
ctgtccaatgccagaagacacctggagaatgtcatgcatatagcagccatcctagaaaag
aactgctcggggctggactgtcaggagcagcactgtgagcagggcttatcactggattct
cacgcactcatgacctacagcacagctcgcatcagcttcgtgtgtccacgtttctatagg
aacgtgcgctgcacctgtaatggaggagtttgcccagggtccaatgatccttgtgtggaa
aaaccgtgtccagaggacatgcaatgtgtgggctatgaggccagcaggagaccatttctt
tgccagtgtccaccagggaaactcggagagtgctcagggcatacttccctcagctttgct
gggaacagttacatcaagtatcggctttctgaaaatagcaaagaagaggacttcaagcta
gctctgcgcctgagaaccctgcaaagcaatggaatcataatgtacactcgggccaacccc
tgcatgattctgaagattgtggaaggcaagctgtggttccagctggactgtggcagcggc
cctgggatcctgggcatctccagccgtgctgtcaatgatgggagctggcactctgtcttc
ttggagctcaatcgcaatttcaccagcctggccctggacgacagctatgtagagcgtcgc
agggctcccctgtacttccagacgctaagcactgacagtgccatcttctttggtgccctg
gtgcaggctgataacgtccgcagcctgacagacacgcgtgttacgcaggtcctcggtggc
ttccagggttgcctggactccgtggtgctcaatcactacgagctacccctccaaaacaag
cgcagcagcttcgcggaggtcgtgggtctgacggagctgaagctgggctgtgtgctctac
ccagacgcgtgccaacgcagcccctgtctgcacgggggcagctgcagcagcttgccctct
ggcggctatcagtgttcctgtctctcgcagttcacgggaacaaactgtgaatcagagatc
acagcctgcttccctaacccttgccggaatggaggatcctgtgaccccataggaaacacc
ttcgtctgcagctgtaaagccggcctcacaggtgtcacgtgcgaggatgatgtggacgag
tgtgagcgagaagaatgtgagaacgggggctcctgtgtcaacctgtttggctccttcttc
tgcaactgcaccccaggctatgtaggccagtactgtggcttgcgccctgtggttgtgccc
aacatccaggctggccactcatatgtgggaaaggaggagctgataggcatcgctgtagtc
ctcttcgtcatcttcacccttatcgtactcttcatcgtctttcgcaagaaggtcttcaga
aagaactactctcgcaacaacatcacattagtgcaggacccggccacagctgcactgctg
cataagagcaacggcatccccttccgcagcctgcgtgcaggagatgggcgcaatgtgtac
caagaggtggggcctccacaggtgccggtgcgccccatggcctacacgccctgtttccag
agtgactccaggagcaatctggacaagggcctggatgtactgggtggtgagccacaggag
atgagcacattccacccagaatctccacgcatcctgaccgcaaggcgaggagtggtggtg
tgcagtgtggcccccaacctaccagctgtgtcaccctgccgctcagactgcgactccatc
cggaagaatggctgggacacaggatctgaaaacaaagggactgaagacacaggagaagtg
acctgcttcacgaacagtaacaaaggcagcaactctgaagttcagtccctcagctccttt
cagtcagactctggagatgacaatgcctatcactgggacacctctgattggatgcctggg
gcacgactgtcagatatcgaagaaatgcccaactatgagagccaagatggaggggcagca
caccagggtagcacacgagagctggagagtgactactacctaggtggatatgacattgat
agtgaatacccaccacctcatgaagaagagttcctgagtcgggatcagctccccccgcca
ctgcctgaggacttccctgaccagtatgaggccctgcctccctcccagcccacctcactc
acgagcaccatgagcccagactgcaggagaaggccccggtttcaccccagtcagtacctc
cctcctcacccactccccggtgaaacggatttggggggcccatcctccagctgtgatttt
agtacttttgcagtaaacatgaaccagggcacagaggtcatggcccccacagacagtgtg
tctctgtccttgcacaattccagaggcacctcatcttcagagatgtcagcccgctgtggc
tttgacgattctgaggtagccatgagtgactacgagagtgcaggcgagctcagccttacc
aaccttcacattccctttgtggaaacacagcagcagacccaggtgtag

DBGET integrated database retrieval system