KEGG   Mus musculus (house mouse): 270151
Entry
270151            CDS       T01002                                 
Symbol
Nlrx1, NOD9
Name
(RefSeq) NLR family member X1
  KO
K12653  NLR family member X1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    270151 (Nlrx1)
   04622 RIG-I-like receptor signaling pathway
    270151 (Nlrx1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    270151 (Nlrx1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    270151 (Nlrx1)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   270151 (Nlrx1)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 NOD2_WH AAA_16 DUF815 TsaE AAA_25 AAA_22
Other DBs
NCBI-GeneID: 270151
NCBI-ProteinID: NP_001157214
MGI: 2429611
Ensembl: ENSMUSG00000032109
UniProt: Q3TL44
Position
9:complement(44164010..44179896)
AA seq 975 aa
MRWGCHLPRTSWGSGLGRTPQLPDEHISFLIQWSWPFKGVHPLRPPRAFIRYHGNSADSA
PPPGRHGQLFRSISATEAIQRHRRNLTEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPSTELATGHQQTQAGLPPLALSQLFDPDSCGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGSTPASLCQLVTQRYTPLKEVLPLMTAAGSRLLFV
LHGLERLNLDFRLAGTGLCSDPEEPGPPAAIIVNLLRKYMLPEASILVTTRPSTISRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPDCGYGAGGASVSVTPAQRDNLIQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTHTSNLS
LMSYAARTMGKLAYEGVSSRKTYFSEEDVRGCLEAGIKTEEEFQLLQIFRRDALRFFLAP
CVEPGHLGTFVFTVPAMQEYLAALYIVLGLRKTALQRVGKEVVEFVGRVGEDVSLVLGIV
AKLLPLRILPLLFNLLKVVPRVFGRMVSKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPSEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLGSLRQLNLAGVRMTPLKCTVVASVL
GSGRHPLDEVNLASCQLDPAGLHTLMPVLLRARKLGLQLNNLGPEACRDLRDLLLHDQCQ
ITTLRLSNNPLTAAGVGLLMDGLAGNTSVTHLSLLHTDLGDEGLELLAAQLDRNKQLQEL
NVAYNGAGDTVALALAKAAREHPSLELLHLYFNELSSEGRQVLRDLGGSGEGGARVVASL
TEGTAVSEYWSVILSEVQRNVHSWDPLRVQRHLKLLLRDLEDSRGATLNPWRKAQLLRVE
GEVKTLLEQLGGSGH
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgaggtggggctgccatttgcccaggacctcttggggctctggcctgggaagaacaccc
cagctaccagatgagcatatctccttcttgatccagtggagctggccctttaaaggggtg
catcccctgaggccccctagggcctttatccgttaccatggaaactcggcagacagtgct
cccccaccagggaggcatgggcagctgttcaggagcatctctgccacagaagctatccaa
aggcatcgccggaacctcaccgagtggtttagccgactgcccagagaggagcgccagttt
ggaccaacctttgctctagacacagttcatgttgaccccgtgatccgagagagcacccca
gatgagctgcttcgcccgtccacggagctggccacggggcatcagcaaacccaggcaggg
ctccccccactggccctgtctcagctttttgacccggattcttgtgggcgccgcgtgcag
accgtggtgttgtatgggaccgtgggtactggcaagagcacgttggtacggaagatggtc
ttagactggtgttacgggagactgcctgcctttgagcttctcatccccttctcctgtgag
gacttgtcatccctgggctccaccccagcttccctgtgccaacttgtgacccagcgttac
acacccctgaaagaggtgttgcccctgatgactgctgcgggatcccgcctgctctttgtg
ctccatggcttggagcgcctcaaccttgacttccggctggcaggcacagggctttgcagt
gacccggaggaacccgggccaccagctgccatcatagtcaacctgctgcgcaaatacatg
cttcccgaggccagcattctggtaaccacccggccttccaccattagccgaatccctagc
aagtatgtgggccgctatggtgagatctgtggcttctctgataccaacctgcagaagctc
tacttccagctccgccttaaccagcctgactgtgggtacggtgctgggggtgccagtgtc
tcagtcacaccagctcagcgcgacaacctgattcaaatgctctcccggaacctggagggg
caccaccagattgccgcagcctgctttctgccttcctattgctggcttgtctgtgctact
ttgcacttcctgcatgctcccacacctgctggtcagaccctcacaagcatctataccagc
tttctacgcctgaacttcagtggggaaacactggacagcacccacacgtccaatctatcc
ctgatgtcctatgcagcccggactatgggcaagctggcctacgagggcgtgtcatcccga
aagacctacttctctgaagaggatgtccgtggctgcctggaagctggcatcaagacagag
gaagagtttcaactgcttcagatcttccgcagggacgccctgaggtttttcctggccccg
tgtgtggaaccagggcacctgggtaccttcgtgttcaccgtgcccgccatgcaggagtat
ctggctgccctctacatcgtgcttggtttgcgcaagacagccctgcagcgggtgggcaaa
gaagtggttgaatttgtgggccgtgttggggaagatgtcagcctggtattgggcattgtg
gccaagctgttgcccctgcggattctgcctctgctcttcaacttgctcaaggtagttccg
cgagtgtttgggcgcatggtgagtaagagccgggaggcagtggcccaggccatggtgctg
gagatgttccgggaggaagactactacaatgacgatgttctggatcagatgggtgccagc
atcctgggtgtggagggcccccggcgccacccagatgaaccctctgaggatgaagtcttt
gagctcttccccatgttcatgggcggacttctctctgcccacaaccgggcggtgctggct
cagcttggctgtcccatcaagaacctggatgccctggagaatgcccaggccatcaagaag
aagctggggaagctgggtcggcaggtgctgcccccctcggagcttcttgaccatctcttc
ttccactatgagttccagaaccagcgcttctcagctgaggtgctgggctccctacgccag
ctcaatttagcaggggtgcgcatgacacccctcaagtgcacagtggtagcctctgtactg
ggaagtggaaggcaccccctggatgaggtgaacttggcctcctgccagctggatcccgct
gggctacacactctcatgcctgtcctcctgcgtgcccggaaactggggttgcaactcaac
aatctgggccccgaggcctgcagagacctccgagacctgctcttacacgatcaatgccag
atcaccactcttaggctctccaacaacccactgacagcagctggtgtgggcttactgatg
gacgggctggcaggaaacacttcggtgacacacctgtctctgctgcacactgaccttgga
gacgagggactggaactgctggctgcccagctggaccgaaacaaacaactgcaggagctg
aacgtggcctacaacggtgctggtgacacagtggctctggccttggctaaggctgctcgg
gagcacccttccctggagctgctgcacctctacttcaatgagctgagttcagagggccgc
caggtcctgcgggatttggggggctctggtgaaggtggtgcccgggtcgtagcctcgctg
acagaagggacggcggtgtctgagtactggtcagtgatccttagtgaagtccagcgcaac
gtccacagctgggacccgctccgggtccagaggcatctcaagctgctgctccgtgatctg
gaggacagccggggcgccacccttaatccctggcgcaaggctcagcttctgcgagtggag
ggcgaggtcaagactcttctggagcagctgggaggttctggacactga

DBGET integrated database retrieval system