KEGG   Mus musculus (house mouse): 270160
Entry
270160            CDS       T01002                                 
Symbol
Rab39, C230094F14Rik, Rab39a
Name
(RefSeq) RAB39, member RAS oncogene family
  KO
K07924  Ras-related protein Rab-39A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    270160 (Rab39)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    270160 (Rab39)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA AAA_33 SRPRB Raptor_N
Other DBs
NCBI-GeneID: 270160
NCBI-ProteinID: NP_780771
MGI: 2442855
Ensembl: ENSMUSG00000055069
UniProt: Q8BHD0 Q0PD15
Position
9:complement(53595410..53617532)
AA seq 217 aa
METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGK
RIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQI
VFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIK
KGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC
NT seq 654 nt   +upstreamnt  +downstreamnt
atggagactatttggatctatcagttccgccttattgtgatcggagactccacggtgggc
aagtcgtgccttctgcaccgcttcacccagggccgcttcccagggctgcactcccccgcc
tgcgaccccacagtcggcgtggacttcttctcgcgcctgctggagattgagccgggcaag
aggatcaagctgcagctctgggacacggcggggcaggagcgcttcagatcaataactcga
tcctattaccgcaactcagttggaggatttttagtgtttgacattactaaccgacggtct
tttgaacatgtgaaagattggctagaagaagcaaaaatgcatgtacagccttttcagatt
gtatttctactggtgggacataaatgtgacctggcttcgcaacgccaggtttcaagggaa
gaagctgaaagactgtcaacagactgtggaatgaagtacatagagacctcagccaaggac
gcgacaaacgttgaagagtcctttacaatcctgacaagagacatatatgagcttatcaaa
aaaggagagatttgtattcaggatggatgggaaggggttaaaagtggtttcgttccaaat
actgtgcattcttctgaggaagcagtcaagcccagaaaagagtgcttctgttga

DBGET integrated database retrieval system