KEGG   Mus musculus (mouse): 270166Help
Entry
270166            CDS       T01002                                 

Gene name
Clpx, AU014732, E330029I21
Definition
(RefSeq) caseinolytic mitochondrial matrix peptidase chaperone subunit
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    270166 (Clpx)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP100
   270166 (Clpx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_2 ClpB_D2-small AAA AAA_5 Sigma54_activat Mg_chelatase AAA_7 AAA_22 AAA_16 RuvB_N Sigma54_activ_2 AAA_14 IstB_IS21 T2SSE TsaE NACHT AAA_24 AAA_18 ABC_tran TIP49 AAA_29 MCM RNA_helicase PduV-EutP
Motif
Other DBs
NCBI-GeneID: 270166
NCBI-ProteinID: NP_035932
MGI: 1346017
Ensembl: ENSMUSG00000015357
Vega: OTTMUSG00000031828
UniProt: Q9JHS4 Q8C4Z5
Position
9 C; 9 35.22 cM
AA seq 634 aa AA seqDB search
MSSCGACTCGAAAARLLTTSLTSAQRGISCGRIHVPVLGRLGTTLDAQALRRAPLRTFSE
TPAYFASKDGANKDGSGDGNKKSVTEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFV
SSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKY
VVGQSFAKKVLSVAVYNHYKRIYNNIPANLRQQAEAEKQTSLTPRELEIRRREDEYRFTK
LLQIAGISPHGNALGASMQQQVNQQMPQEKRGGEVLDSSQDDIKLEKSNILLLGPTGSGK
TLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDE
VDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNVLFVA
SGAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLL
RHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCE
LNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKE
PGYIRAPSKESSEEEYDSGVEEDGWPRQADAANS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttgcggcgcttgtacctgcggcgctgcggccgcccggcttctcaccacttcg
ctcacctccgcgcagagaggtatttcgtgtgggcgaatccatgtgccagtgttaggaaga
ctggggacgaccttggacgctcaggctctgcgcagagctcctcttagaaccttttcagaa
acaccagcatactttgcctcaaaagacggggcaaacaaggatggctccggagatggaaat
aagaaatcagtgactgaaggaagcagtaagaaatcaggctctgggaattctgggaaaggt
ggaaaccagcttcgctgtcctaaatgtggtgatttgtgtacacacgtggagacctttgtg
tcttccacgcgttttgttaagtgtgaaaaatgtcatcatttttttgtggtgctgtcggaa
gcagactcaaagaaaagcataattaaggaacccgagtccgctgcagaggctgtgaagttg
gcattccagcagaagccacctccgccccccaaaaagatttataactacctcgacaagtat
gttgttggccagtcgtttgctaagaaagtgctttcagttgccgtgtataatcattataag
agaatatataataatattccagctaatctgagacagcaagcagaggctgagaagcagaca
tcactaacacctagagagttagaaataagaagacgggaggatgagtacagatttacaaag
ttgcttcagatcgctgggatcagcccacacggcaatgccttgggagcctctatgcagcag
caggtaaaccagcaaatgcctcaggagaaaagaggaggtgaagtgttggactcttctcaa
gatgatataaaactggaaaaaagtaatattttgctgcttggaccaactgggtcaggtaaa
acccttctggcacaaactttagctaaatgccttgatgttccttttgctatctgtgactgt
acaactttgacccaggctggatatgtaggtgaagatattgaatctgtgattgccaaacta
ctccaagatgccaattacaatgtagagaaagcacaacaaggaattgtctttctggatgaa
gtagataagattggcagtgtgccaggcattcatcaattacgggatgtaggtggagaaggc
gttcagcaaggtttattaaaacttctagaaggcacaatagtcaatgttccagaaaagaat
tctcgaaaactacgtggagagacagttcaagttgatacaacaaatgtcttgtttgtggca
tctggtgcctttaatggcttagacagaatcatcagcaggaggaaaaatgaaaagtatctc
ggctttggaacaccatctaacctgggaaagggcagaagggctgcagctgcagcggatctt
gctaaccgaagtggggaatctaacactcatcaggacattgaggagaaagaccggttactc
cgccatgtggaagccagagatcttattgagtttggcatgataccagagtttgtgggacgg
ttgcctgtggtggttcctttgcacagcctagatgagaagacacttgtacaaatactgacc
gagccacggaatgctgttattcctcagtatcaggccttgttcagcatggataagtgtgag
ctgaatgttactgaggatgctctgaaagccatagcgagattggccctggaaagaaaaaca
ggtgcacgaggccttcggtctataatggaaaagctgttactagaaccaatgttcgaagtt
cctaattctgacattgtatgtgtggaagttgacaaagaagtagtagaaggcaaaaaggaa
ccaggatacattcgggcaccctcaaaagagtcctctgaagaggaatatgactctggagtg
gaggaggatggatggcctcgtcaagcggatgctgcaaacagctaa

DBGET integrated database retrieval system