KEGG   Mus musculus (house mouse): 270192
Entry
270192            CDS       T01002                                 
Symbol
Rab6b, 9630015C03, AI844641, C330006L04Rik, D9Bwg0185e
Name
(RefSeq) RAB6B, member RAS oncogene family
  KO
K07894  Ras-related protein Rab-6B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    270192 (Rab6b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    270192 (Rab6b)
   04031 GTP-binding proteins [BR:mmu04031]
    270192 (Rab6b)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    270192 (Rab6b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   270192 (Rab6b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    270192 (Rab6b)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA
Other DBs
NCBI-GeneID: 270192
NCBI-ProteinID: NP_776142
MGI: 107283
Ensembl: ENSMUSG00000032549
UniProt: P61294 Q0PD53
Position
9:102988866..103062475
AA seq 208 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVI
IMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENV
QEKSKEGMIDIKLDKPQEPPASEGGCSC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtccgcagggggagattttgggaacccgctgcgaaaattcaagttggttttcctaggg
gagcagagcgtcgggaagacgtctctgatcacgaggttcatgtatgacagcttcgacaac
acctaccaggcaaccatcgggattgacttcttgtcaaaaaccatgtacttggaagaccgt
acggttcgactgcagctctgggacactgctgggcaagagaggttccgcagcctgatcccc
agctacatccgagactccacggtggctgtggtggtatatgacattactaatctcaactcc
ttccagcagacttctaaatggattgatgacgtcaggacggagaggggcagtgacgtgatc
atcatgcttgtgggtaacaagacggatctggctgataagaggcagataaccatcgaggaa
ggagaacagcgggccaaagaactgagcgtcatgttcatcgagaccagcgcgaagactggc
tacaacgtgaagcagctcttccgacgtgtggcgtcagctctgcccggcatggagaatgtc
caggagaagagcaaagaagggatgattgacatcaagctggacaagcctcaggagcccccg
gccagcgagggcggctgctcctgttaa

DBGET integrated database retrieval system