KEGG   Mus musculus (mouse): 270198
Entry
270198            CDS       T01002                                 

Symbol
Pfkfb4, C230090D14
Name
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  KO
K19030  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 4 [EC:2.7.1.105 3.1.3.46]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00051  Fructose and mannose metabolism
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    270198 (Pfkfb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    270198 (Pfkfb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     270198 (Pfkfb4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     270198 (Pfkfb4)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Prefoldin KTI12 His_Phos_2 AAA_18 Zeta_toxin
Other DBs
NCBI-GeneID: 270198
NCBI-ProteinID: NP_766607
MGI: 2687284
Ensembl: ENSMUSG00000025648
Vega: OTTMUSG00000027454
UniProt: Q6DTY7
Position
9; 9 F2
AA seq 469 aa
MASPRELTQNPLKKIWMPYSNGRPALHASQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRKQCALAALSDVRKFLSE
EGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVVAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVW
TSQMKRTIQTAEALSVPYEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPAHQ
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcgtctccacgggaactgacccagaatcccctgaagaagatctggatgccgtacagc
aatggcaggcccgctctgcacgccagccagcgtggtgtctgcatgactaactgtccgaca
ctcattgtcatggtgggcctgccagcccggggcaagacctacatttctaagaagctgacg
cggtacctcaactggattggcgtgcctactcgggaattcaacgttggtcagtatcgccgg
gacatagtcaagacgtacaaatcttttgagtttttcctcccagacaatgaagaaggcctg
aaaatcaggaagcagtgtgccttagcagccctcagtgatgtccggaagttcctcagtgag
gaggggggacatgtggcggtttttgatgcaaccaatacgacccgagagcggagagcgatg
atctttaactttggagaacagaatggctacaagaccttctttgttgaatctatctgtgtg
gatcctgaggttgttgctgccaacatcgtgcaagtgaagctgggcagccctgactatgtc
aaccgggacagcgacgaagccaccgaagacttcatgaggcgcattgaatgctatgaaaac
tcatatgagtcgctggatgaagacctggacagggatctgtcctacatcaagatcatggac
gtgggccagagctatgtggtgaaccgtgttgctgatcacatccagagtcgcatcgtttat
tacctcatgaacatccatgtgacaccccgctccatctacctctgccggcatggggagagc
gagctaaacctcaagggccggattggtggggatcctggactgtccccccggggccgggag
ttttccaagcatctggcccagttcatcagtgaccagaacattaaggatctgaaggtctgg
acgagccagatgaagaggacgatccagacagccgaggcgctgagcgtcccttatgagcag
tggaaggtcctcaacgagatcgatgcgggcgtctgtgaggaaatgacctacgaagaaatc
caggatcactacccgctggagtttgccctgcgggatcaggacaagtaccggtaccggtac
ccgaagggtgagtcctatgaagacctggtgcagcggctggagcccgtcatcatggaactg
gagaggcaggagaatgtgttggtcatttgccaccaggctgtcatgcgctgcctcctggcc
tacttccttgacaaggcagctgaagagctgccctacctcaaatgccccttgcacacagtc
ctgaagctcacacccgtggcttacggttgtaaagtggagtccatattcctgaacgtggca
gctgtgaacactcaccgagacagacctcagaatgtagacatatccaggccttcagaggaa
gcccttgtcacagtccctgctcaccagtga

DBGET integrated database retrieval system