KEGG   Mus musculus (mouse): 27041Help
Entry
27041             CDS       T01002                                 

Gene name
G3bp1, AI849976, B430204O07, C87777, G3bp, mKIAA4115
Definition
(RefSeq) GTPase activating protein (SH3 domain) binding protein 1
  KO
K17265  Ras GTPase-activating protein-binding protein 1 [EC:3.6.4.12 3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    27041 (G3bp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    27041 (G3bp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     27041 (G3bp1)
    3.6.4.13  RNA helicase
     27041 (G3bp1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     27041 (G3bp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   27041 (G3bp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTF2 RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 27041
NCBI-ProteinID: NP_038744
MGI: 1351465
Ensembl: ENSMUSG00000018583
Vega: OTTMUSG00000005694
UniProt: P97855
Position
11; 11 B1.3
AA seq 465 aa AA seqDB search
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYAHGGLDSNGKPADAVYGQKE
IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSV
ANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQTVSN
DLEEHLEEPVVEPEPEPEPEPEPEPVSDIQEDKPEAALEEAAPDDVQKSTSPAPADVAPA
QEDLRTFSWASVTSKNLPPSGAVPVTGTPPHVVKVPASQPRPESKPDSQIPPQRPQRDQR
VREQRINIPPQRGPRPIREAGEPGDVEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQN
FGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGAVRLNVEEKKTRAAREGD
RRDNRLRGPGGPRGGPSGGMRGPPRGGMVQKPGFGVGRGITTPRQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggttatggagaagcctagtcccctgctggtcgggcgggagtttgtgcgacagtactac
actctgctgaaccaggccccggacatgttgcacagattttatggaaagaactcttcctat
gcccacgggggcttggattccaacgggaagccagcagatgcagtctacgggcagaaggaa
atccacaggaaagtgatgtcacaaaacttcaccaactgccacaccaagatccgccacgtg
gatgctcacgcaactctgaatgacggggtggtggtccaagtgatggggctactgtccaac
aacaaccaggctctgcggaggttcatgcagacctttgtccttgctcctgagggctctgtt
gccaacaaattctatgttcacaacgacatcttcaggtaccaagatgaggtcttcggtggc
tttgtcacagagcctcaagaggaatccgaggaagaagtagaagaacctgaagaaagacag
cagacaccagaggtggtgcctgatgattctggaactttctatgatcagactgtcagcaat
gacttggaggagcatttagaggagcctgtagtggaaccagaaccggagccagagccggag
ccggagccggaacctgtgtccgacattcaagaggacaagcctgaggctgcattggaagaa
gctgctcccgacgatgtgcagaagagcacttccccggccccggctgatgtggccccggca
caggaggacttgaggacgttttcttgggcatctgtgacgagtaagaaccttcctcccagt
ggggctgttccagtgacggggacaccacctcatgtggtcaaagtgccagcgtcacagccc
cgtccagaatctaaacctgactctcagatcccaccacaaaggcctcagagagatcagaga
gttcgagagcagcgaatcaatatccctcctcagagaggaccccgaccaatccgtgaggct
ggtgaaccaggagatgtggaacctcgaaggatggtgaggcaccctgacagtcaccagctc
ttcattgggaacctgccacatgaggttgacaagtcggaactgaaggattttttccaaaat
tttggcaatgtggtggagctgcgcatcaacagtggtgggaagttacccaatttcggtttt
gttgtgtttgatgattctgaacctgttcagaaggtccttagtaataggcccatcatgttc
cgaggcgcggtccgcctgaatgtggaagagaagaagactcgagctgccagagaaggcgac
cgcagggataaccgccttcggggacctggaggcccccgtggtgggccgagtggtgggatg
agaggccctccccgcggaggcatggtgcagaaaccaggctttggcgtgggcagggggatt
acaactccaaggcagtga

DBGET integrated database retrieval system