KEGG   Mus musculus (mouse): 27047Help
Entry
27047             CDS       T01002                                 

Gene name
Omd, OSAD, SLRR2C
Definition
(RefSeq) osteomodulin
  KO
K08124  osteomodulin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    27047 (Omd)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    27047 (Omd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_5 LRR_1 LRR_6 LRR_9
Motif
Other DBs
NCBI-GeneID: 27047
NCBI-ProteinID: NP_036180
MGI: 1350918
Ensembl: ENSMUSG00000048368
UniProt: O35103
Position
13; 13 A5
AA seq 423 aa AA seqDB search
MGFLSPIYVLFFCFGVRVYCQYEAYRWDDDYDQEPNEDYDPEFQFHQNIEYGVPFYNNIL
GCAKECFCPTNFPTSMYCDNRKLKTIPIIPMHIQQLNLQFNDIEAVTANSFINATHLKEI
NLSHNKIKSQKIDYGVFAKLSNLQQLHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTN
AMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEKLMQLNLCNNRLESMPLGLPSSLMYLSL
ENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPR
NLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSI
YYGEQRSTNGETIQLKTQVFRSYQEEEEEDDHDSQDNTLEGQEVSDEHYNSHYYEMQEWQ
DTI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttaagtccaatatatgtccttttcttctgttttggagttagagtatactgc
caatatgaagcttaccgatgggatgacgattatgaccaagagccaaatgaggattatgat
ccagaattccaatttcatcaaaatattgaatatggagttcccttttataataatatttta
ggttgtgctaaggaatgcttctgtccaactaactttccaacatcaatgtactgtgacaat
cgtaaactcaagactatcccaattattccaatgcacattcagcaactcaaccttcagttc
aatgacattgaggctgtgactgcaaattcattcatcaatgcaactcatcttaaagaaatt
aaccttagccacaacaaaattaaatctcaaaagattgattatggtgtattcgctaaactt
tcaaatctacaacaacttcatctagagcacaataacctagaagaatttccatttccactt
ccaaaatctttggaaagactccttcttggttataatgaaatctccatacttccaacaaat
gccatggacgggctggtgaatgtgactatgcttgacctctgctataatcatctttctgat
tcgatgttaaaagaaaagaccctttccaaaatggaaaaattaatgcagctcaacctatgt
aataacagattagaatcaatgccccttggattgccttcatcacttatgtatctatcttta
gaaaataattcaatttcatctataccagacaattattttgacaaacttccaaaacttcat
gctctaagaatatcacacaacaaactggaagacattccatatgacatctttaatctttcc
aatcttatagaactcaacgttggacacaataaattgaagcaagcattctacattccaagg
aatttggaacatctatacctacaaaataatgaaatagaaagcatcaatgtgacaatgata
tgtccttctcctgatccagtacaccatcaccatttaacataccttcgtgtggaccaaaat
aagctgaaagaaccaataagttcatacatcttcttctgcttccctcgtatacacagtatt
tattatggtgagcagaggagtactaacggtgaaacaattcaactgaagacccaagttttc
aggagctaccaagaggaggaagaggaagacgaccatgacagtcaggacaacactcttgag
ggtcaagaagtatcagatgagcactataattctcattactatgagatgcaagagtggcaa
gatactatatag

DBGET integrated database retrieval system