KEGG   Mus musculus (mouse): 27049
Entry
27049             CDS       T01002                                 

Symbol
Etv3, AI414410, METS, Pe1
Name
(RefSeq) ets variant 3
  KO
K09433  ETS translocation variant 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    27049 (Etv3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    27049 (Etv3)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 27049
NCBI-ProteinID: NP_001076787
MGI: 1350926
Ensembl: ENSMUSG00000003382
Vega: OTTMUSG00000026642
UniProt: Q8R4Z4
Position
3:87432884..87447465
AA seq 513 aa
MKAGCSIVEKPEGGGGYQFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGE
YGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKL
VMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDSHSPTGDVQPGRFSASSLSASGPE
SGVTTDRKVEPSDLEDGSASDWHRGMDFMPSRNALGGGAVGHQKRKPDILLPLFTRPAMY
PDPHSPFAISPVPGRGGVLNVPISPALSLTPTMFSYSPSPGLSPFTSSSCFSFNPEEMKH
YLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEEPSQFSIKLQPPPAGRKNRERVE
SREEAVRGSVPASAPVPSRIKVEPATEKDPDSLRQSTQGKEEQTQEVDSMRSRTIEEGKG
TGFAHPSPTWPSVSISTPSDEPLEGTEDSEDRSVREPGVPEKKEDALMPPKLRLKRRWND
DPEARELNKTGKFLWNGAGPQGLATTATAAADA
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaaagcaggctgtagcatcgtggaaaagccagaaggaggtggagggtatcagtttccg
gattgggcctacaaagccgagtcgtcgccgggctcccggcagatccagctgtggcacttc
atcctggaactgctgcagaaggaagagttccgccatgtcatcgcctggcagcagggagag
tacggggagtttgtcatcaaggatccagatgaagtggctcgcctctggggccgcaggaag
tgcaaaccacagatgaactatgacaagctgagccgggccctcagatactattacaacaag
aggatccttcataaaacaaaagggaaaaggtttacttacaagtttaacttcaacaagctc
gtgatgcccaactacccgttcatcaacattcgctcgagtggtgtggttcctcagagtgcg
ccaccagtgccaacagcctcctcccggttccatttcccacctctagacagccattctcct
actggcgatgtgcaaccgggtcgcttctctgccagctcactgagtgcttctggccctgag
tcaggggttaccactgacaggaaggtcgagccttcggacctggaagatggctcggcctct
gactggcaccggggcatggacttcatgccctcccgaaatgctctgggcggaggagcagtc
ggccaccagaaacgcaagcctgacatactgcttcctctcttcacccggccagccatgtac
cctgacccgcacagtcccttcgctatctctccggtccctggccgcggaggggtccttaat
gtccccatctcaccagccctgtccctgactcccaccatgttctcctacagtccctcacca
ggcctgagccccttcaccagcagcagttgcttctccttcaacccagaggaaatgaaacac
taccttcattctcaagcctgttcggtgttcaactaccatctgagtccccggactttcccc
cgttacccagggctcatggtcccaccgctgcagtgccaaatgcatcctgaggagccttcc
cagttctccatcaagctgcagcccccgccggctggacggaagaaccgcgagagggtagag
agccgggaggaggctgttcgcggctctgtgcccgccagcgctcctgttccctctcggatt
aaggtagagccggccacagagaaggatcctgacagcctccggcagtcaacccagggaaag
gaggaacagacccaagaagtggacagcatgcggagcaggaccatagaagaggggaaaggc
accgggtttgcccacccctcacccacctggccctctgtgtccattagcactcccagtgac
gaacccctagaggggaccgaagacagtgaggacaggtctgtcagggagcccggtgtaccc
gagaagaaagaagacgccctgatgccccctaagcttcggctgaagaggcggtggaatgac
gaccctgaagccagggagctcaacaaaacgggcaagttcctctggaatggggcaggaccc
cagggcctggccacaacggccactgctgccgctgatgcttaa

DBGET integrated database retrieval system