KEGG   Mus musculus (mouse): 27052Help
Entry
27052             CDS       T01002                                 

Gene name
Aoah, 4930433E13Rik
Definition
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    27052 (Aoah)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     27052 (Aoah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2 Lipase_GDSL_2 Cu-binding_MopE
Motif
Other DBs
NCBI-GeneID: 27052
NCBI-ProteinID: NP_036184
MGI: 1350928
Ensembl: ENSMUSG00000021322
UniProt: O35298
Structure
PDB: 

Position
13; 13 A2
AA seq 574 aa AA seqDB search
MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSS
VQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQP
QCHLYPLPQEAWESALEKARQVLRRSSTMKYPRSGRNICSLPFLTKICQKIELSIKKAVP
FKDIDSDKHSVFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDG
IPYEKKFCEGSQPRGIILLGDSAGAHFHIPPEWLTASQMSVNSFLNLPSALTDELNWPQL
SGVTGFLDSTSGIEEKSIYHRLRKRNHCNHRDYQSISKNGASSRNLKNFIESLSRNQASD
HPAIVLYAMIGNDVCNSKADTVPEMTTPEQMYANVMQTLTHLNSHLPNGSHVILYGLPDG
TFLWDSLHNRYHPLGQLNKDVTYAQFFSFLRCLQLNPCNGWMSSNKTLRTLTSERAEQLS
NTLKKIATTETFANFDLFYVDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASLLQAN
RVWEKIQLQWPHVLGKENPFNSQIEEVFGDQGGH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccctggaaagtcttcaagaccacccttctgcttcttctgctctctcactca
ttggcctctgtgccctctgaggaccagccaggtgacagctactcccatggccaaagctgt
ttagggtgtgtggtactggtatctgtgattgagcaactggctgaagttcacaactcttca
gtccaggtggcgatggagagactctgcagctacctgcctgaaaagctgttcttgaagacc
gcctgctatttcttggttcagacatttggctcagacatcataaaactactcgatgaagct
atgaaggctgatgtggtgtgctatgctctggaattttgcaagcggggtgctgtccaacca
cagtgtcatctctacccacttccccaggaggcctgggagtctgcactggagaaggcgaga
caagtcctcaggaggtcctctaccatgaaatatcccagaagtggtcgtaacatttgttcc
ctaccatttttgaccaagatctgccagaaaattgaattatctataaagaaggccgtgcca
ttcaaagacatagattcagacaagcacagtgttttcccaacgctgcggggctaccactgg
cgagggcgtgactgtaatgacagtgacaagacagtgtacccgggcagaaggccagacaac
tgggatatccatcaggactccaactgtaatggcatctggggtattgatccgaaagatgga
attccatatgagaagaaattctgtgaaggttcacagcccaggggaatcattttgctggga
gactcagctggggctcattttcacatcccccctgaatggctgacagcttcacagatgtct
gtgaactccttcctcaacctgccgtccgcccttaccgatgagctcaactggccccaactc
tctggtgtaactggatttctggactccacgagtggaattgaagaaaaatccatttaccat
cgtttgagaaagagaaaccattgcaatcacagagactatcagagtatctcaaaaaatggt
gcatcttccagaaatctgaagaattttattgaaagcttgtctaggaaccaggcatcagac
catccagccattgtcctttatgccatgattggaaacgatgtttgtaattcgaaagctgac
acagtaccagaaatgaccactcctgaacaaatgtacgccaacgtcatgcagactctgaca
catctaaattctcacctgcccaatggcagccacgttattttatacggcttaccagatgga
acttttctctgggatagcttgcacaaccgataccaccctctaggccagctaaataaagat
gtgacctatgcacagttcttctcctttctaagatgcctgcagctcaatccctgtaacggc
tggatgtcttccaacaagaccctccggactctcacttcagagagagccgaacaactctcc
aatacactgaaaaaaattgcaaccaccgagacgtttgcaaacttcgatcttttctacgtg
gattttgccttccatgaaataatagaggactggcagaaaagaggtggacagccatggcag
cttattgaacctgtggatggattccaccccaatgaggtggcttcacttctgcaagcaaat
cgtgtctgggaaaagatacagcttcaatggcctcatgtcctgggaaaggagaatccattc
aactctcagattgaagaggtgtttggagaccaaggaggacactga

DBGET integrated database retrieval system