KEGG   Mus musculus (mouse): 27054Help
Entry
27054             CDS       T01002                                 

Gene name
Sec23b
Definition
(RefSeq) SEC23 homolog B, COPII coat complex component
  KO
K14006  protein transport protein SEC23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27054 (Sec23b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    27054 (Sec23b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    27054 (Sec23b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical Gelsolin zf-Sec23_Sec24 APP_E2
Motif
Other DBs
NCBI-GeneID: 27054
NCBI-ProteinID: NP_001239472
MGI: 1350925
Ensembl: ENSMUSG00000027429
Vega: OTTMUSG00000003918
UniProt: Q9D662
Position
2; 2 G1
AA seq 767 aa AA seqDB search
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYM
IQRGARSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQEMLGLTKSAMPVQQARPAQPQEQPFVSSRFLQPIHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKTPIRSWHDIEKDNARFMKKATKHYEMLANRTATNGHCIDIYACALDQTGLL
EMKCCPNLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLDVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPSSTLGIYFEVVNQHNAPVPQGGRGA
IQFVTQYQHSSTQKRIRVTTIARNWADAQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAS
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtatctggaattcattcagcagaatgaagaacgagatggtgtgcgtttcagt
tggaacgtgtggccttctagccgccttgaagccacaagaatggttgtgcccttggcttgt
ctcctcactcctttaaaagaacgcccagacttacctcctgtacagtatgaacctgtgctt
tgcagtaggcctacctgcaaagctattctcaatccactttgtcaagtggattaccgagca
aaactctgggcctgcaatttctgttttcaaagaaatcagttccctccagcatatgcaggc
atatctgaggtgaatcaacctgctgaattgatgccccagttctccacaattgagtacatg
atccagagaggtgctcggtctcctctgatctttctctatgtggttgacacgtgtttggag
gaagatgaccttcaagcactcaaagagtccctgcagatgtctctgagtctccttcctcca
gatgccctggttggtctcatcacttttgggaggatggtgcaggttcatgagctaagctgt
gaaggaatctccaagagctatgtcttccgagggaccaaggatttaactgcaaagcaaata
caggagatgctgggcctgaccaagtcagccatgcctgtgcagcaagccagacctgctcaa
cctcaggagcagccttttgtttccagcagatttctacagcccattcacaagattgacatg
aacctcacagatcttctcggggagctgcagagggacccatggccagtaactcaggggaag
agaccactgcggtccactggtgttgctttgtccattgctgttggcttgttggaggggact
ttcccaaatactggagccaggatcatgctgttcactggcgggcccccgacccaaggacct
ggcatggtggttggagatgagttgaagactcctattcgttcctggcacgacattgagaaa
gataacgcacgattcatgaagaaggcaaccaagcattatgagatgcttgctaatcgaact
gctacaaatggccactgcattgatatttatgcttgtgcccttgaccaaactggacttctg
gagatgaagtgctgtccaaatcttacaggaggccacatggtgatgggagattctttcaac
acttctcttttcaagcagacattccaaagaatttttagtaaagacttcaacggagatttc
agaatggcgtttggtgctacgttggatgtaaagacctctcgggaactgaagattgcagga
gccattggtccatgcgtgtctctgaatgtgaaagggccatgcgtgtcagaaaatgagctt
ggtgttggtggcacaagtcagtggaagatctgtggcctggatccctcatctactcttggc
atctactttgaagttgtcaatcagcacaatgctccagttccccagggaggcagaggtgcc
atccagtttgtcacacagtatcagcattccagcactcagaagcgcatccgagtgaccacc
attgcccgcaattgggcagatgcacagagtcagctgaggcacatagaagcagcatttgac
caggaggccgcagcagtcctgatggcacggcttggagtgttccgcgcagagtcagaggag
gggcctgacgtgcttcggtggctggatcggcaactcatcagactgtgtcagaagtttggg
cagtataacaaagaagaccctacgtctttcagattgtcagactccttttctctgtatcct
cagttcatgttccatctgagaagatctccatttcttcaagtatttaacaacagtcctgat
gagtcctcctattatagacaccattttgcccggcaggatctgactcagtccctcattatg
atccagcccattctctattcttactccttccacggaccaccagagcctgtactcctggac
agcagtagcattctagctgacagaattctgctgatggatactttcttccaaattgtcatt
taccttggtgagaccatagcccagtggcggaaggctggataccaggacatgcccgagtat
gaaaacttcaagcaccttcttcaggcgcccctggatgatgcccaagaaattctgcaagca
cgcttcccaatgccacgttatatcaacacagagcatggcggcagtcaggctcggttcctg
ttgtctaaagttaacccatctcagacacacaataacctgtatgcctgggggcaggaaact
ggagcgcccatcctgacagacgatgtcagcctacaggtgttcatggatcacctgaagaag
ctggctgtgtctagtgcctcttaa

DBGET integrated database retrieval system