KEGG   Mus musculus (mouse): 27056
Entry
27056             CDS       T01002                                 

Gene name
Irf5, AW491843, mir, mirf5
Definition
(RefSeq) interferon regulatory factor 5
  KO
K09446  interferon regulatory factor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    27056 (Irf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    27056 (Irf5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    27056 (Irf5)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 27056
NCBI-ProteinID: NP_036187
MGI: 1350924
Ensembl: ENSMUSG00000029771
Vega: OTTMUSG00000035855
UniProt: P56477 Q3U169
Position
6 A3.3; 6 12.36 cM
AA seq 497 aa
MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEV
CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKW
PPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLIS
PHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPS
PEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPI
QREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPV
AARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVA
GLDASQGPWPMHPVGMQ
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaaccactcagccccagggattcccccaccaccccgccgtgtgaggctgaagccctgg
ttggtggcccaggtgaacagctgccagtacccagggcttcagtgggtcaacggggaaaag
aaactcttctatataccctggcgccatgccacgaggcatggtcccagccaggatggggac
aacaccatcttcaaggcctgggctaaagagacagggaagtacactgaaggggtggatgag
gctgacccagccaagtggaaggccaacctgcgctgtgcccttaacaaaagccgtgacttc
cagctgttctatgatggccctcgggacatgccacctcagccgtacaagatctacgaggtc
tgctccaacggccctgctcccacagagagccaacccactgatgattacgttctgggagaa
gaggaggaggaggaagaggaagagctccagagaatgctaccaggcctgagcatcacagag
cctgcgctacctgggcctcccaacgcaccctattccttacccaaagaagacaccaagtgg
ccacctgctctccagccacctgtagggctgggtccccctgtcccagacccaaatctcctg
gcccctccctctggaaatcctgctggcttcaggcagcttctccctgaggtcctggagcct
ggacctctggcttccagccagccccctacagaaccactcttgcctgacctgctgatcagc
ccccacatgttgcctttgacggacctagagatcaagttccagtaccggggacgcgcaccc
cggaccctcaccatcagcaacccacaaggctgcaggctcttctacagccagctagaggct
acccaggagcaagtggaactctttggccctgtgaccctggagcaagtgcgcttccctagc
ccagaggacatccccagtgacaagcagcgtttctatacgaaccagctgctagatgtcctg
gaccgtgggctcatcctgcagctgcagggccaggacctgtacgccatccgtctgtgccag
tgtaaggtgttctggagtgggccctgcgccttggcccatggctcctgccccaaccccatt
cagcgggaagtcaagacgaagctctttagcctagagcagtttctcaatgagctcatcctg
ttccagaagggccagactaataccccaccaccttttgagatcttcttttgctttggagaa
gaatggcctgatgtcaaaccccgagagaagaagctcattactgtacaggtggtacctgtt
gcagcccggttgctgctggagatgttctcaggggagctttcttggtcggcagacagcatc
cgactgcagatctcaaacccggatctcaaagaccacatggtagagcagtttaaagagctt
catcacctctggcagtcccagcagcaattgcagcccatggtccaggcccctcctgtggca
ggcctcgatgcaagccaggggccctggcccatgcacccagttggcatgcaataa

DBGET integrated database retrieval system