KEGG   Mus musculus (house mouse): 27057
Entry
27057             CDS       T01002                                 
Symbol
Ncoa4, ARA70, Rfg
Name
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04216  Ferroptosis
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    27057 (Ncoa4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27057 (Ncoa4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    27057 (Ncoa4)
SSDB
Motif
Pfam: ARA70 CARD
Other DBs
NCBI-GeneID: 27057
NCBI-ProteinID: NP_001029160
MGI: 1350932
Ensembl: ENSMUSG00000056234
UniProt: Q5U4H9
Position
14:31881836..31901812
AA seq 625 aa
MNTSLEQSGCYSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEYTQNKDLANQVSV
CLERLGSLALKPEDSTVLLFEADTSALRQTITTFGSLKTIQIPEHLMAHASSSSIGPFLE
KRGYIQVPEQKSASSGTAVSLSEWLLVSKPAIGLQAPYVPSTNPQDWLIPKQTSENSQTS
ARACSFFSDAWGNLKGLENWLLNSHQQEIAGKPSSSKCNSHCSTSSFSPEAEKAEDVELL
DQDELDLSDWLVTPQEPCELEKPVDGSWETSEKFKLLFQVFREPYNVSDWLVKPDSCTNC
QGNQPRGVEIENLGNLKCLNDHLEAKKSVSVPGATISDGWLAQNHQDTWKVEEVCKANEP
CTSFAECVCDDNCEKEAMYKWLLKKGGKDKNGMPMEPKSEPEKHRESLTLWLCPSRNELT
EQAKAPKAMAPARIADSFHVIKNSSLSEWLMGPTCKGGPKDVPNTEERAGKEMLQSSMAT
SWCPFNTADWVLPGKKVGSLSQFPSGEDKWLLRKKAQEAFLNSPLQEERNFRPDCYGLPA
VCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaacacatccctggaacagagtggctgctacagtaatagagaaactcttctgaggtgc
agtgatgcaaggagggagctggagcttgctattggtggagtacttcgggctgaacagcaa
attaaagataatttacgagaggtaaaagctcagattcacagctgcataagtcgccacctg
gaatgccttcggagccgagaggtgtggctcaatgaacaggtcgatctcatctatcagctt
aaagaggagacactgcagcagcaggctcagcagctctattggctaatgggccaattcaat
tgtcttattcatcaactggagtatactcagaacaaagatcttgccaatcaagtctctgtg
tgcttggagagactgggcagtttggccctgaagcctgaagattcaactgtcctactcttt
gaagcagatacatctgctctgcgccagaccatcaccacatttggatcccttaagaccatt
caaatccctgagcatctgatggctcacgcgagctcctcaagtattgggcctttcctagag
aaaagaggctatatccaggtgccagagcagaagtcagcatccagtggcacagctgtatct
ctgagtgagtggcttcttgtaagcaaacctgccattggtcttcaggctccttatgtaccc
agtaccaacccacaggactggcttatcccaaaacagacttcagagaatagtcagacttct
gccagagcctgcagtttcttcagcgatgcctggggcaatctgaagggcttagaaaattgg
ctccttaacagtcatcaacaagaaattgctggaaaaccaagttcctcaaaatgtaacagc
cattgtagcaccagttctttctctcctgaagctgaaaaggctgaagatgtagagctcctt
gatcaagacgagctggacctgtctgattggttggtgactcctcaggaaccctgtgagctg
gagaagcctgtggatggcagctgggaaaccagcgagaagtttaaactcttgttccaggtg
ttcagagagccctacaatgtgagtgattggcttgtcaagcctgactcctgtaccaactgt
cagggcaaccagcctagaggtgtggagattgagaacctgggcaatctgaaatgcctaaat
gaccacttggaggccaaaaaatcagtgtcggtccccggcgcaacaatcagcgacggctgg
cttgcccagaaccatcaggacacatggaaagtagaggaagtgtgtaaagccaacgagccc
tgcaccagttttgcagagtgtgtgtgtgatgacaactgtgagaaggaagccatgtataaa
tggcttctgaagaagggaggaaaggacaagaatggaatgcctatggaacctaaatctgag
cctgagaaacacagagagtccctgacactgtggctctgcccttccagaaatgagctaaca
gaacaagctaaggcacccaaggctatggctcctgctagaattgctgattccttccacgtc
ataaagaatagttccttgtcagagtggcttatggggcctacgtgcaaaggaggccctaag
gacgtgcctaatacagaggagagagctggcaaagagatgcttcaaagctccatggccact
tcctggtgtccctttaacactgccgactgggttttaccaggaaagaaagtgggaagcctc
agccagttcccctctggagaagataagtggctacttcgaaagaaggcacaggaagcattt
cttaattcacccctacaagaagaacgtaactttcgccccgactgttacggcctcccagca
gtttgtgatctctttgcctgtatgcagcttaaggttgataaagaaaaatggctgtacaga
actcctctacagatgtga

DBGET integrated database retrieval system