KEGG   Mus musculus (mouse): 27061
Entry
27061             CDS       T01002                                 

Gene name
Bcap31, BAP, Bap31
Definition
(RefSeq) B cell receptor associated protein 31
  KO
K14009  B-cell receptor-associated protein 31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27061 (Bcap31)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    27061 (Bcap31)
SSDB
Motif
Pfam: Bap31 Bap31_Bap29_C APG6_N Sec34 Atg14 DUF4407 Spc7 GAS Rx_N PIG-U DUF3498 DUF730
Other DBs
NCBI-GeneID: 27061
NCBI-ProteinID: NP_001300627
MGI: 1350933
Ensembl: ENSMUSG00000002015
Vega: OTTMUSG00000017693
UniProt: Q61335
Position
X; X A7.3
AA seq 245 aa
MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILV
LLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEEN
KSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPS
VKKEE
NT seq 738 nt   +upstreamnt  +downstreamnt
atgagtttgcagtggactacagttgccaccttcctctacgcagaggtctttgctgtgttg
cttctctgcattcccttcatttctccaaaaagatggcagaaggtttttaaatcccggctg
gtggagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgta
ctgttggttattgatgctgtacgagagatcctgaaatacgatgatgtgacagaaaaggtg
aacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcag
aggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtg
actctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggca
gaaagtgccagtgaggcggccaagaaatacatggaggagaatgatcagctaaagaaggga
gctgccgaggatggagacaagttggatattgggaatactgaaatgaagttagaggagaac
aagagcctgaagaatgacctgaggaagctaaaagatgagctggccagcaccaagaaaaaa
cttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaa
gaatatgaccgcctgctagaagaacatgccaaactgcaggcatcagtacgtggtccctca
gtcaagaaggaggagtaa

DBGET integrated database retrieval system