KEGG   Mus musculus (mouse): 270669
Entry
270669            CDS       T01002                                 

Gene name
Mbtps2, 9630032G22Rik, AI662535
Definition
(RefSeq) membrane-bound transcription factor peptidase, site 2
  KO
K07765  S2P endopeptidase [EC:3.4.24.85]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    270669 (Mbtps2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    270669 (Mbtps2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.85  S2P endopeptidase
     270669 (Mbtps2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M50: S2P protease family
   270669 (Mbtps2)
SSDB
Motif
Pfam: Peptidase_M50 PDZ_2 DUF3446
Other DBs
NCBI-GeneID: 270669
NCBI-ProteinID: NP_758511
MGI: 2444506
Ensembl: ENSMUSG00000046873
Vega: OTTMUSG00000019403
UniProt: Q8CHX6
Position
X; X F4
AA seq 515 aa
MIPVSLLVVVVGGWTAVYLADLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTSIFNRA
FYSWGRRKARMLYQWFNFGMVFGVIAMFSSFFLLGKTLMQTLAQMMADSPSPYSSSSSSS
SSSSSSSSSSSSLHNEQVLQVVVPGINLPVNQLTYFFAAVLISGVVHEIGHGIAAIREQV
RFNGFGIFLFIIYPGAFVDLFTTHLQLISPVQQLRIFCAGIWHNFVLALLGILALVLLPV
ILLPFYYTGVGVLITEVAEDSPAIGPRGLFVGDLVTHLQDCPVTNVQDWNECLDTIAYEP
QIGYCISASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNFNKRLHTCLPARKA
VEATQVCRSNKDCKSGASSSFCIVPSLETHTRLIKVKHPPQIDMLYVGHPLHLHYTVSIT
SFIPRFNFLSIDLPVIVETFVKYLISLSGALAIVNAVPCFALDGQWILNSFLDATLTSVI
GDNDVKDLIGFFILLGGSVLLAANVTLGLWMVTAR
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgattccggtgtcgctgctggtggtggtggtgggtggttggactgccgtctacctggcc
gacttggtgttgaagtcatctgtgtattttaaacattcttatgaagactggctggaaaac
aatggattgagcatctctccttttcatataagatggcaaacttcaatttttaatcgtgcc
ttttacagttggggacggcggaaagcaaggatgctttaccaatggttcaattttggaatg
gtgtttggcgtgattgccatgttcagctctttttttctccttggaaaaacactgatgcag
actttggcacaaatgatggctgactctccctctccttattcttcctcttcctcttcctcc
tcttcctcttcctcctcttcctcttcctcctcctctcttcacaatgaacaggtgttgcaa
gttgtggttcccggtataaatttacctgtcaatcagctgacttacttcttcgctgcagtc
ctcattagtggtgttgtacatgaaattggacacggtatagcagctattagggaacaagtt
cgatttaatggctttggaatttttctcttcattatttatcctggggcatttgttgatctg
ttcaccacccatttgcaacttatatcaccagtccagcagctaaggatattttgtgcaggt
atatggcataattttgtccttgctctccttggtattttagctcttgttctcctcccagta
atcctcttgcctttttactacactggagttggggtacttatcactgaagtcgcagaggac
tcacctgccattggacccagaggcctttttgtgggagaccttgtcactcatctacaggat
tgtcccgttactaatgtgcaagattggaatgaatgtttagacaccattgcatatgagccc
caaattgggtattgtataagtgcatcaacgttacaacaattaagcttcccagttagagca
tacaaacgactagatggttctactgaatgctgtaacaatcacagcctcacagatgtgtgc
ttttcctacagaaataatttcaataaacgtttgcatacgtgtctacctgcccggaaagca
gttgaagctactcaagtttgtagaagcaataaagattgcaaaagcggcgcaagttctagc
ttctgtatagtaccgtccttggaaactcacacccgactaatcaaagtgaaacatcccccg
caaattgatatgctgtatgtagggcacccactgcatcttcactacacagtgagcattaca
agtttcatcccacgtttcaactttctaagcatagatctgccagtgattgtggagacattt
gtcaagtacctgatttctctttctggagctctggctattgttaatgcagtgccctgcttt
gccttggatggtcaatggattttaaactctttcctggatgctacccttacttcagtaatt
ggagacaatgatgtcaaagatctgattggatttttcatcttgcttggtggcagtgtactt
ttggctgccaatgtgacactgggactctggatggttacagcacggtaa

DBGET integrated database retrieval system