KEGG   Mus musculus (mouse): 270757Help
Entry
270757            CDS       T01002                                 

Gene name
Bpifc, 4732454E24, Bpil2
Definition
(RefSeq) BPI fold containing family C
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP LBP_BPI_CETP_C
Motif
Other DBs
NCBI-GeneID: 270757
NCBI-ProteinID: NP_808440
MGI: 3026884
Ensembl: ENSMUSG00000050108
Vega: OTTMUSG00000021304
UniProt: Q8C186 Q3V1D7
Position
10; 10 C1
AA seq 507 aa AA seqDB search
MRTKQVPVLWACFLLWSLYIASSQTVYPGITARITQRALDYGLQVGMKVLEQLAKEIVIP
DLNGSESLKFLKIDYVKYNFSNIKINAFSFPNTSLAFVPGVGIRALSNHGTANISTNWSV
KAPLFRDSGAANLFLSGIYFTGIVAFTRNDFGYPALELQDCHVQVSHARVSFFGSLSALY
NSFAEPMEKPILKNLNEMLCPIAISQVEQFNVNISALEVLTKIDNYTVLDCSLISPPEIT
ENHLDFNLKGAFYPLESLVDPPFTPAPFHLPESRDSMLYIGISEYFFKSASFAHYVSGAL
GTTLSTREISNYFSQNVQGFGSVLSKIAEIYVLSQPFILQMMATGPPMVNLQRNNFSLEF
PAAVIMLTQLDNSTIQPIVSMDFVASTSVGLAILGQKLICSLSLNRFRLSLPENSQRDAK
VVRFENILSSILHFGVLPLANTKLQQGFPLPNPYNISFINSDIEVLEGYLLVSSDLAYDT
SSKPQPNLNSWGDLNLVHRPWREQPTH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaagcaggtcccagtcctctgggcatgctttctcctatggagtctctacatt
gcctcctcccagactgtctaccctggaatcacggcgaggatcacccagcgtgcactagac
tatggtcttcaagttgggatgaaggtactggagcaattggcaaaggaaatcgtcatccca
gatttgaacggttctgagtctcttaaatttctgaagattgactatgtaaagtacaacttc
tcaaacataaaaatcaatgccttctcattcccaaatacctcactggccttcgtacctggg
gtaggcatcagagcactgagcaaccacggcactgccaacatcagcaccaactggagcgtc
aaggctccacttttccgagactcgggagctgccaatctgttcctctctggaatctatttc
actggcatcgttgcctttacccgtaatgactttggttacccagctctggaactccaagac
tgccatgttcaagtgagccatgcccgagtctcatttttcggaagtctcagtgccctgtat
aactcctttgctgagcccatggagaaacccattctaaagaatttaaatgaaatgctttgt
cccattgccatcagccaagtggaacagttcaatgtcaacatcagcgcactggaggtttta
accaagattgacaactacacagtgctggattgttccctgatcagtcctccagaaatcacc
gagaaccaccttgactttaatttgaagggtgcgttctaccctctggaaagcctcgtggac
cctcccttcacaccagctcccttccatctcccagagagcagagattccatgctctacatt
ggcatctctgagtacttctttaaatctgcgtcatttgctcactatgtatctggggctctt
ggtaccacgctgtccactagggagatttccaactatttcagtcaaaatgttcaaggattt
ggcagcgtactctccaagattgcagagatctatgtcttgtcccagccgttcatactgcag
atgatggccacagggcctcctatggtcaacttacaacgaaacaatttcagcctggagttc
cctgctgctgtcatcatgctcactcaactggataactctaccatccagcccatcgtctcc
atggacttcgttgctagtaccagtgttggcctggctattttgggacaaaaactgatctgc
tccttatctttgaacagattccgcctgtctttgccagagaacagccaacgagatgctaag
gttgtgagatttgagaatatcctgtcttccattcttcacttcggcgtcctcccactggcc
aacacaaaactgcagcaaggatttcctcttcccaacccctacaatatctcattcatcaat
tcggatattgaagttcttgagggttaccttctggtttctagtgacctggcatatgacaca
tcctcaaagccacagccaaatctgaacagctggggggatctgaacctagtacatagacca
tggagagaacagccaacccattga

DBGET integrated database retrieval system