KEGG   Mus musculus (mouse): 270802Help
Entry
270802            CDS       T01002                                 

Gene name
E030027L10
Definition
(RefSeq) cDNA sequence BC048403
  KO
K23297  KICSTOR complex protein C12orf66
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    270802 (E030027L10)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   KICSTOR complex
    270802 (E030027L10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C12orf66_like
Motif
Other DBs
NCBI-GeneID: 270802
NCBI-ProteinID: NP_766610
MGI: 2670984
Ensembl: ENSMUSG00000053684
Vega: OTTMUSG00000027722
UniProt: Q6P1I3
Structure
PDB: 

Position
10; 10 D2
AA seq 445 aa AA seqDB search
MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANKSAGGSWLSLLAALAH
LAAAEKVYHSLTYLGQKLGGQSFFSRKDSIRTIYTSLHNELKKVVAGRGAPGGTAPHVEE
LLPHLSEQLCFFVQARMEIADFYEKMYALSTQKFINTEELVSTLDTILRKYSSRFHHPIL
SPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTKLQSWGQTFEKQRETKKHL
FGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGK
ISSFIRKYDAANVSLIFDNRGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMH
WPNVIMIMTDRASDLNSLEKVVHFYDDKVQSTYFLTRPEPHFTIVVIFESKKSERDSHFI
SFLNELSLALKNPKVFASLKPGSKG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggggagtctatcccgctagccgccccggtgccggtggaacaggcggtgctggagacg
ttcttctctcacctgggtatcttctcttacgacaaggccaaggacaatgtggagaaggaa
cgagaggccaacaagagcgcggggggcagctggctgtcgctgctggcggccttggcgcac
ctggccgcggctgagaaggtctatcacagcctcacctacctggggcagaaactagggggc
cagtcattcttcagcaggaaagactccatccgcaccatctacacttccctgcataacgaa
ctgaagaaagtggtggccggccgcggcgccccgggcggaacggctcctcacgtggaggag
cttctcccccacctgtcagagcagctctgtttctttgttcaggctcggatggagatcgca
gacttctacgagaagatgtacgccctcagcacacagaagttcatcaacacagaagagctg
gtcagcaccttggataccatcctcaggaagtacagctccagatttcaccaccccatcctc
agccctctggagagcagtttccagctggaagtgggcgtgctgagtcatctcctcaaggcg
caggcgcagatctcggagtggaagttcctcccgtccctggttaccttgcacaacgctcac
acgaagcttcagagctggggccagacctttgagaagcagcgggagaccaagaagcacctg
ttcggaggacagtctcagaaggccgtgcagccgccacaccttttcctctggctgatgaaa
ctcaagaccatgctcttggccaagttcagcttttacttccacgaggcgctgagccgacag
acgaccgcgtccgaaatgaaagcgctgacggccaaggccaacccggacctctttggaaag
atctccagttttatcaggaaatacgacgctgccaacgtctccttaatttttgacaaccgg
ggctcagagagctttcagggtcatggctaccaccacccacattcctaccgagaggccccc
aagggagtggaccagtacccagccgtggtgtctctgcccagtgacaggcccgtcatgcac
tggcccaatgttatcatgatcatgacagaccgagcatctgacctgaacagcttggagaaa
gtggtccacttctacgacgacaaagtccagagcacctacttcctgacccgcccggaaccc
cacttcaccatcgtcgtcatttttgagtcaaagaaatctgagagagactcccattttatt
tccttcctcaacgagctctcgcttgcccttaagaaccccaaagtgtttgcaagtctgaag
cctggatccaaaggttag

DBGET integrated database retrieval system