KEGG   Mus musculus (mouse): 27081
Entry
27081             CDS       T01002                                 

Symbol
Zfp275, 5430431L06Rik, AI593314, DXBay20, DXHXS52, DXPas8
Name
(RefSeq) zinc finger protein 275
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    27081 (Zfp275)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    27081 (Zfp275)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    27081 (Zfp275)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 zf-met zf_UBZ zf-C2H2_8 zinc_ribbon_15 HypA zf-C2H2_11 Ribosomal_L34e C1_4
Other DBs
NCBI-GeneID: 27081
NCBI-ProteinID: NP_001153701
MGI: 1350985
Ensembl: ENSMUSG00000031365
Vega: OTTMUSG00000017691
UniProt: Q3UQ14
Position
X:72386190..72402686
AA seq 377 aa
MGEEAQLQEMASTSSPRANDPSAEVKQNGDSGGRGGSPQNLPIEHHFACKECGDTFRLKV
LLVQHQRVHSEEKGWECGDCRKVFRGVSEFNEHRNSHAAVAAQPRPGPSRALEDALEKRE
QMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGQSFKANTHLFRHQKLHT
SEKPFACKACSRDFLDRQELLKHQRMHTGHLPFDCDDCGKSFRGVNGLAEHQRIHSGAKP
YGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKAFRQSSSLLEHTRIHSGERPYACG
DCGKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSSGLSRHRRIHSGVKRCECSECGR
VFKRRSALQKHQPSHRE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggtgaagaagcccagctgcaagagatggcgtccacgagttccccgagggccaatgac
cccagcgctgaggtcaaacagaatggggactctgggggaaggggagggagcccacaaaat
ctgcccatagaacaccattttgcatgtaaagagtgtggggacaccttccgccttaaagtg
ctccttgttcagcaccagagggttcacagtgaggagaagggctgggagtgtggcgattgc
aggaaggtcttcaggggggtgtcagaatttaatgagcacaggaacagccacgcagctgtg
gccgctcagccccggcctggccccagtcgggctctggaagatgccttggaaaagagggag
caaatggagagggaggcgaagccctttgagtgtgaggagtgcgggaaaaggtttaagaag
aacgcaggccttagtcagcacctgagggtgcacagcagagagaagccctttgattgtgag
gagtgtgggcagtccttcaaagccaacacccacctctttcgacatcagaagcttcacact
tcggaaaagccctttgcgtgcaaggcgtgcagcagggatttcctggaccgccaggaactt
ctcaagcaccagcggatgcacacaggccacctgcccttcgactgcgatgactgcggcaag
tccttccgtggtgtcaacggcctggcagagcaccagcgcatccacagcggcgccaaaccc
tacgggtgtcctcactgcggcaagctgttccggaggagctcagagctcaccaagcaccgg
aggatccacactggtgagaagccctatgagtgcaaccagtgcggcaaggccttccgccag
agctccagcctgctggagcacacacgcatccatagcggtgagcggccttatgcatgcggc
gactgcggtaaggccttccgagggccttctgacctcatcaagcacaggcgcatccacagc
ggactgaaaccctatgagtgcgacaagtgtggcaaggcctttaggaggagctcaggcctg
agccgccaccgtcggatccacagtggggtcaagcgctgtgagtgcagtgagtgtggccgc
gtgttcaagaggcgctcggcactgcagaaacaccagccctcccatcgcgagtaa

DBGET integrated database retrieval system