KEGG   Mus musculus (house mouse): 27083
Entry
27083             CDS       T01002                                 
Symbol
Xlr4b, Xlr4
Name
(RefSeq) X-linked lymphocyte-regulated 4B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Cor1 YkyA YlbD_coat DUF2145 SUZ KxDL
Other DBs
NCBI-GeneID: 27083
NCBI-ProteinID: NP_001280605
MGI: 1350975
Ensembl: ENSMUSG00000067768
UniProt: Q9JJQ7
Position
X:72257928..72266059
AA seq 215 aa
MASKIKGRPPKQPKVTPALPSNDSQQLHENNPGNNLALETCGESSSSHGTGGPKPGPSKK
TLNERKRKYGVSVNKTVQNIEWNVDHFLKVQHERRQELYKDYSHQFLTLVMMWNIDVDQI
KKQAGKLSDILDEQQKLFQQFQSIHMQKIEEFKELCDRHLKNLQAIKCCRRKAIIEEARK
LMDYLEKRVTEETVHVNKQEAKDGVQSSLLSLLIS
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcttccaaaatcaagggcagacctcccaagcaaccaaaggtgactcctgctctgcca
tctaatgattcacagcagcttcatgaaaataacccaggaaacaatctggcccttgaaact
tgtggggaaagcagttcttcccatggaacaggtggaccaaagccagggcccagtaagaaa
actctaaatgaaaggaagagaaagtatggggtgagtgtaaataaaactgtccaaaacatt
gagtggaatgttgaccacttcttgaaagtccagcatgagcgaaggcaggaactttataag
gactattctcatcagtttttgactttggttatgatgtggaatatagatgtagaccaaatc
aagaaacaggctggaaaactctctgatatacttgatgagcaacagaagctttttcaacaa
tttcaaagtattcatatgcagaaaatagaagaatttaaggagttatgtgatcgacacttg
aagaatctacaggctattaagtgttgtcgccgaaaagctattattgaggaagccagaaag
ctaatggactacttggaaaagagagttactgaagaaactgttcacgtaaacaagcaggaa
gcaaaggatggtgttcaatcatcacttctatccctgctaatctcgtaa

DBGET integrated database retrieval system