KEGG   Mus musculus (mouse): 27096
Entry
27096             CDS       T01002                                 

Symbol
Trappc3, 1110058K12Rik, AI835942, AU019197, Bet3
Name
(RefSeq) trafficking protein particle complex 3
  KO
K20302  trafficking protein particle complex subunit 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    27096 (Trappc3)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    27096 (Trappc3)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    27096 (Trappc3)
SSDB
Motif
Pfam: TRAPP
Other DBs
NCBI-GeneID: 27096
NCBI-ProteinID: NP_038746
MGI: 1351486
Ensembl: ENSMUSG00000028847
Vega: OTTMUSG00000009355
UniProt: O55013 Q3U9K9
Structure
PDB: 

Position
4; 4 D2.2
AA seq 180 aa
MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIEDFL
ARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPD
NHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtcgaggcaggcgaaccgtggcacggagagcaagaaaatgagttctgagctgttcacg
ctgacctatggagcgcttgtcacccagctgtgcaaggactatgaaaacgacgaagacgtg
aacaagcagctggacagaatgggctacaacattggagtccgactgattgaagattttttg
gcacggtcaaatgttggaagatgtcatgactttcgggaaactgcagatgttattgctaag
gtggcgttcaagatgtacctgggcatcactccaagcatcaccaactggagcccagccgga
gatgaattctccctcatcctggaaaacaaccctctggtggactttgtggagcttcccgat
aaccactcggccctcatttactccaacctcctgtgtggggtgttgcggggagccctggag
atggtccagatggctgtggaggccaagtttgtccaggacactctgaagggagatggcgtg
acagaaatcaggatgaggttcatcaggcggattgaagacaacctcccagctggagaagag
taa

DBGET integrated database retrieval system