KEGG   Mus musculus (mouse): 271144Help
Entry
271144            CDS       T01002                                 

Gene name
Ankdd1b, 9330128J19Rik
Definition
(RefSeq) ankyrin repeat and death domain containing 1B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank Death NTP_transf_8
Motif
Other DBs
NCBI-GeneID: 271144
NCBI-ProteinID: NP_001036179
MGI: 2444730
Ensembl: ENSMUSG00000047117
Vega: OTTMUSG00000042851
UniProt: Q14DN9
Position
13; 13 D1
AA seq 465 aa AA seqDB search
MRAMNRTALHFAVGRNSLSAVDFLLSHKARVDVADKHGLTVIHLAAWSGSFEIMLMLVKA
GADQRAKNQEGMNALHLAAQNNNLHIVDYLIHDLHLHDLNQPNERGRKPFHLAAERGHVE
MIEKLIFLNLHTSEKDKDGNTALHLAAMHGHSPAVQVLLTQWSEVNESNENGETPFLLAV
VGGHEECSRVLLAGGSDVNIPNKLNVSALQTATRNGHTALVNFLLGENADLQQQKESKEP
PLHLAVINNRPAVVNSLLSARHDVDVLDQRRQTPLHVAADLGNVELVETLLKAGCNLKIT
DKQGKTALAVAARSQHSLVVDMLIKAERYYAWREEHRESIQDSAVSSTLTFKQDHSLETR
QIRTLLWNLAYRQLKKKDWQRLARLWSFTEDQIRAIEEQWSGNDSFHEHGYRALLIWLHG
ALLTQLDPAKQLYEELLCAGFPELAEKIRQFKSKTDSSSKKCAVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagggctatgaaccgcacagccctgcactttgccgtggggaggaatagtttatctgca
gtggatttcttactgagtcacaaagccagggtggatgttgctgacaagcatggtttgaca
gtcattcacctggcagcctggtctggaagcttcgagatcatgctcatgctagttaaagct
ggagcagaccagagagccaagaaccaggaaggaatgaacgctctccacttggcagctcag
aacaacaacctgcacattgtggactacctcattcacgacttgcacctgcacgacctgaac
cagcccaatgagagaggaagaaaaccatttcatttggcagctgagaggggccacgttgaa
atgattgaaaagcttatcttccttaatctccatacctcagaaaaagacaaggatgggaac
acggccttgcacctggctgcaatgcacggtcacagcccagccgtgcaagtgctactaact
cagtggtcagaagtcaatgagagcaatgagaatggagaaaccccattcctgttggctgtt
gtgggaggtcatgaagaatgcagtcgcgtgctcctggcaggaggaagtgatgtcaacatt
ccaaacaaactcaatgtcagtgccttgcagacagcgacccggaacggccacacagccctt
gtcaactttcttctcggtgagaatgctgatttgcagcagcagaaggaatctaaggagccc
cctcttcacctagcagttatcaacaaccgccccgcagtcgtgaacagcttactaagtgct
cggcatgatgttgatgtcttagatcagaggcggcagacccctctgcacgtagctgctgat
cttggaaatgtggagctggtggagacactgctgaaggctggctgcaacctgaaaatcact
gacaagcaaggaaagactgccctggcggtggctgccaggagccagcacagcctcgtcgtg
gatatgctgatcaaagctgagaggtactacgcctggagagaggagcaccgtgagagcatc
caggactcagcagtgagctctacactgacgttcaagcaggaccatagtctggagaccagg
caaatccgcacactgctctggaacctggcctatcggcagctgaaaaagaaagactggcag
aggctggcccgcttgtggagttttacagaggaccagatcagagccattgaggaacagtgg
tcaggtaatgacagcttccatgagcatggctacagggctctgctcatctggctgcacggg
gctctgctgacacagctggaccctgccaagcagttgtatgaggagctgttgtgtgcagga
ttcccagaactagctgaaaagattcggcagttcaaaagcaaaactgactcaagctccaag
aaatgtgcagtctcctaa

DBGET integrated database retrieval system