KEGG   Mus musculus (mouse): 271221
Entry
271221            CDS       T01002                                 

Gene name
Rubcnl, 5031414D18Rik, Gm744, Gm911, Kiaa0226l
Definition
(RefSeq) RUN and cysteine rich domain containing beclin 1 interacting protein like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-RING_9
Other DBs
NCBI-GeneID: 271221
NCBI-ProteinID: NP_001361143
MGI: 2685590
Ensembl: ENSMUSG00000034959
Position
14; 14 D3
AA seq 463 aa
MLPADVEKENLHFYAADIIISVIENMKCNLPNQQQPERWDTEDASRLRGTGAEMTFYTHI
KQEPGSSASSHTGCEGCAALQVSPVAETLSYCPVAGEACKHDLNKLVMLELGKYNDITKG
CRCSYNSSKSATCESNLSPAGCLARELFRGFCKCWMLSEVNCQLPGSPTTASSGVGDEEY
AEEDFDSSVDAAREVMLKSRVPGTEDWVLPRCQIILTVHPPIKRDIAVVAQNFFCAGCGT
PIQPKFVKRLRYCEYLGKYFCASCHSSAESCIPARILTMWDFRKYQVSDFSKWLLDSVWH
QPVFKLLGGHHSLYAKAKELDRVKDLQEQLFHIKKLLKTCRFADSVLKEFEQVPSHLTDE
CHIFSMDDFLRTKKGLLAPLLKDILRASLAHVDSCELCQGKGFICEFCQSTTVIFPFQTT
TCRRCAACRACFHKQCFQSSRCPRCARIIARRQHLESLPTAAT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgctgcccgctgatgtagaaaaggaaaatctccacttttatgctgcagacatcattatc
tcagtaatagagaatatgaagtgcaacctcccgaatcaacagcagccagagagatgggac
acagaagacgccagcaggttacgtgggactggagcggaaatgaccttttatacccatata
aagcaggagccaggctcctcggcttcttcacacactggctgtgaaggttgtgctgcactc
caggtcagcccagtggctgagaccctttcttactgccctgtggcaggagaggcctgcaaa
catgacttgaacaagttggtcatgttagaacttgggaaatataatgacatcacgaaaggc
tgcagatgctcctataactcttcaaagagtgcgacctgcgagtcaaacctcagtcctgct
gggtgcttagccagagagttgttccgagggttctgtaagtgctggatgctgtcagaagtt
aattgccagctgccaggctcaccgaccacagctagctcaggagtcggggatgaagaatat
gctgaggaagactttgactccagtgtggatgctgctcgggaagtcatgcttaagtctagg
gtcccaggaactgaagactgggtgctccctcgatgccaaatcatacttactgttcaccca
ccaatcaagagggacatagcagtggtggcccagaacttcttctgtgctggatgtgggact
ccaatacagcccaagtttgtgaagaggctccggtactgtgagtatctcgggaagtacttc
tgtgccagctgccactcatctgcagagtcttgtatccctgcgcggatcctgacgatgtgg
gacttcaggaagtaccaagtcagcgatttctctaaatggctcttggacagcgtatggcat
caacctgtcttcaaactgttaggtggccatcacagcctctatgcaaaagctaaggaactg
gatagggtgaaggaccttcaggagcaactttttcatatcaagaagctattgaagacttgc
aggtttgctgacagtgtgctgaaggagtttgagcaagttcccagccacttgactgatgaa
tgccacatattctccatggacgacttcctcaggaccaagaaaggactgttggcacctttg
cttaaagacatcctgagagcttctcttgcccacgtggacagctgtgagctgtgccagggg
aagggcttcatttgtgagttttgtcagagcacgacggtcatcttcccatttcagaccacg
acttgtagaagatgtgcagcgtgcagggcctgctttcacaaacagtgtttccagtcttcg
agatgcccgcgctgtgccaggatcatagcccggagacaacatttggagagcttgcccact
gcagcaacatga

DBGET integrated database retrieval system