KEGG   Mus musculus (mouse): 27140Help
Entry
27140             CDS       T01002                                 

Gene name
Tlx3, Hox11l2, Rnx, Tlx1l2
Definition
(RefSeq) T cell leukemia, homeobox 3
  KO
K15607  T-cell leukemia homeobox protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    27140 (Tlx3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, H2.0
    27140 (Tlx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Pilt Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 27140
NCBI-ProteinID: NP_064300
MGI: 1351209
Ensembl: ENSMUSG00000040610
Vega: OTTMUSG00000005392
UniProt: O55144
Position
11; 11 A4
AA seq 291 aa AA seqDB search
MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGAAYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgccagcgcgcagaccccacacccgcacgagcccatcagcttcggcatc
gaccaaatcctcaacagcccggaccaggacagcgcgcccgccccgcggggccccgacggc
gccagctacctgggagggccccccgggggccgtccgggcgccgcgtacccgtctctgccc
gcctcctttgcgggcctcggcgcgcccttcgaggacgcgggatcttacagtgtcaaccta
agcttggcccccgccggcgtgatccgggtgccagcgcacaggccgctccctggggccgtg
ccgccgcctctgcctagcgcgctgcccgctatgccctcggtgcccacggtctccagccta
ggcggcctcaatttcccctggatggagagcagtcgccgctttgtaaaggaccgcttcaca
gcggcggccgcgctcacgcccttcaccgtgacccggcgcattggccacccctaccagaac
cggacgccacccaagcgtaagaagccgcgcacgtccttttcccgggtgcagatctgtgag
ctggaaaagcgcttccatcgccaaaagtacctggcctcggccgagagggcggcgctcgca
aagtccctcaaaatgacggacgcgcaggtcaagacctggttccaaaatcggaggaccaag
tggcggcggcagacggcggaggagcgggaggcggagcggcagcaggcgagccggctcatg
ctacagctgcaacacgacgccttccagaagagcctcaacgattccatccagcccgacccg
ctctgtctgcacaactcgtcgctctttgctctgcagaatctgcagccctgggaggaggac
agttccaaggtccccgctgtcacctctctggtgtga

DBGET integrated database retrieval system