KEGG   Mus musculus (mouse): 271424
Entry
271424            CDS       T01002                                 

Gene name
Ip6k3, D830007E07Rik, Ihp, Ihpk3
Definition
(RefSeq) inositol hexaphosphate kinase 3
  KO
K07756  inositol-hexakisphosphate 5-kinase [EC:2.7.4.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    271424 (Ip6k3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.21  inositol-hexakisphosphate kinase
     271424 (Ip6k3)
SSDB
Motif
Pfam: IPK
Other DBs
NCBI-GeneID: 271424
NCBI-ProteinID: NP_766615
MGI: 3045325
Ensembl: ENSMUSG00000024210
Vega: OTTMUSG00000028132
UniProt: Q8BWD2
Position
17; 17 A3.3
AA seq 396 aa
MVVRHSSDKGKIGVGVPLEPFLHQVGGHLSVLQYDAYTVCKPLVSQEQKFYESLPLAMKC
FTPKYKGTITVRLRRDSRGHLGLVANPLKENLEPFQVSPESRAVALWQTLQQTTGSESSP
CPLTQLARSLKESAAKVLLRSDCHLSTQASPLVESEDGSQVERKGFNPWGLHCHQAHLTR
LCSQYPEDKRHRFLLLENVVSQYKQPCILDLKMGTRQHGDDASEEKKARHMKKCAQSTSA
CLGVRICGMQVYQTDQKSFLCKDKYYGRKLSVEGFRQALSQFLHDGTRLRAELLEPILRR
LQALLTVIRSQSSYRFYSSSVLIIYDGEPPQTTQGSTSGGVTSGDPAKVDVRMIDFAHTT
FKGSWNEHTTYEGPDPGYIFGLENLIGILRDIQEGE
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggtggtgcggcacagctcggacaaggggaagataggggtgggtgtgccactggagccc
ttcctgcaccaggtcgggggccacctgagtgtgctgcagtatgacgcctacacagtctgc
aagccccttgtctcccaggaacagaaattctatgagtccctgccactggccatgaagtgc
ttcactccgaagtacaaaggtaccatcacagtgcgtctccggagagacagcagaggccac
cttggcctggttgccaacccactgaaggagaacctggagcctttccaggtctccccagag
tccagagcggtagctctctggcagacacttcagcagacaaccggcagcgagagcagcccc
tgccccctcacccagctggctcgctcactgaaggagagtgcagccaaggtgctcctgagg
tccgactgccacctcagtacccaggcctctccgctggtggaaagtgaagatgggagccag
gtggagagaaagggctttaacccatggggcctgcactgtcaccaagcccacctgactcgt
ctgtgctcccagtacccagaggacaagagacaccggttcttgctgttggaaaatgtggtg
tcacagtacaagcagccctgcatcctggatctgaagatggggacccgccagcatggggac
gatgcatccgaggagaagaaggcccgtcacatgaagaagtgcgcacagagcacctcggcc
tgtctgggtgtgcgcatctgtggcatgcaggtttatcaaactgatcagaagagctttctc
tgcaaagataagtactatggaaggaagctctcggtggagggattcaggcaagccctttct
cagttcctccatgatggaacccgcctccgcgccgagctcctggagcccatcctgcgtagg
ctgcaggcgctgctcactgtcatcaggagccagagttcttaccgcttctactccagctcc
gtcctcataatctatgatggggagcctccccagaccacccaaggcagcacttctggcggc
gtcacttccggagacccggccaaagttgatgtccggatgattgacttcgctcacacgaca
ttcaagggctcctggaacgagcacaccacctacgagggaccagatcctggctatattttt
ggcctggaaaacctcattgggattctgcgggatatccaggaaggagaatga

DBGET integrated database retrieval system