KEGG   Mus musculus (house mouse): 271711
Entry
271711            CDS       T01002                                 
Symbol
Tmem169, A830020B06Rik
Name
(RefSeq) transmembrane protein 169
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TMEM169
Other DBs
NCBI-GeneID: 271711
NCBI-ProteinID: NP_780773
MGI: 2442781
Ensembl: ENSMUSG00000026188
UniProt: Q8BG50
Position
1:72323510..72342263
AA seq 297 aa
MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRKDSRPESIIIYRSDNE
KTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTLTGTITRGKKKGQMVDI
HVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLWTLVCLPVVFVLSFVVSF
YYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAA
WWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISGNLSNKDPIQEVETSTV
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagagtcggcaccggtggaaagtcagggtcagctcccaagcccccaccacggctca
ctgaggagggcagtggctgctgtcctggccctggatggggaatccacattgggccgcagg
aagaagaggaggaaagactcccgcccggaatccatcatcatctaccggtcagataatgag
aagacggatgaggagcctgaagaatctgaaggtggagatcggcctaaagaggaagagggg
gaggacttcctggactatcctggggatgatggtgtgtggaacatgcctctggacagccgc
tatgtcacactaaccgggaccatcacacgagggaagaagaagggtcagatggtggatatc
catgtcactctgacagagaaggagctgcaggagctgaccaaacccaaggagctgtccagg
gaagcagcccccgagggaaggagggcctgccaggtcggggcggaccaggggccacacgtg
gtcctctggacactggtctgcctgcctgtggtctttgtgctctctttcgttgtgtctttc
tattatggcaccatcacctggtacaacatctttctggtgtacaatgaagagaggaccttc
tggcataagatctcctgctgtccgtgcctcattctcttctacccagtgctcatcatgacc
atggcctcttccctggggctctatgccgccgtggctcagctctcatggtcctgggcagcg
tggtggcgagctgcctgtgacatggagaaaggcttctgtggttggctctgcagcaagctg
ggtctggaggactgttctccctacagcattgtggaactgctggagtctgataatatctcg
ggcaatctctccaacaaggaccccatccaggaggtagaaacctctactgtctag

DBGET integrated database retrieval system